MELO3C025554.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGGTCTCTCTTTTTCATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA ATGGCTAGGTCTCTCTTTTTCATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA ATGGCTAGGTCTCTCTTTTTCATGGCTTCTCTTCTCCTCTTCGTCGTATCAATGTCATCCATCACCGCAACAAGGGCACAGTTGGATTTGCTTGGTGGCTATAAACCAATAAAGGACATAGCTGATCCATACATCCAAAGCATAGGGGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTGAACTGAAATTCCAAAAAGTGATCAGTGGAAAATTTCAGATTGTTGCTGGGACAAACTACCATCTACGATTAACGGCGCTCGAGGGAACTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAAGGAAAACCACCTTATCTTATTCTATGGCATCACAAACTAA MARSLFFMASLLLFVVSMSSITATRAQLDLLGGYKPIKDIADPYIQSIGEFAVNEHNKQAKTELKFQKVISGKFQIVAGTNYHLRLTALEGTVSRTYGTLVFTDLKKENHLILFYGITN
BLAST of MELO3C025554.2 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 212.2 bits (539), Expect = 9.4e-52 Identity = 108/119 (90.76%), Postives = 113/119 (94.96%), Query Frame = 0
BLAST of MELO3C025554.2 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 170.2 bits (430), Expect = 4.1e-39 Identity = 85/119 (71.43%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of MELO3C025554.2 vs. NCBI nr
Match: XP_023520236.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 167.9 bits (424), Expect = 2.0e-38 Identity = 83/119 (69.75%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of MELO3C025554.2 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 166.8 bits (421), Expect = 4.5e-38 Identity = 84/119 (70.59%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of MELO3C025554.2 vs. NCBI nr
Match: XP_022973093.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 166.4 bits (420), Expect = 5.9e-38 Identity = 84/118 (71.19%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-14 Identity = 41/103 (39.81%), Postives = 68/103 (66.02%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 64.7 bits (156), Expect = 4.4e-11 Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 29/90 (32.22%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 53.5 bits (127), Expect = 1.0e-07 Identity = 35/108 (32.41%), Postives = 58/108 (53.70%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-07 Identity = 32/99 (32.32%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of MELO3C025554.2 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 2.6e-13 Identity = 41/103 (39.81%), Postives = 68/103 (66.02%), Query Frame = 0
BLAST of MELO3C025554.2 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.5e-13 Identity = 39/94 (41.49%), Postives = 61/94 (64.89%), Query Frame = 0
BLAST of MELO3C025554.2 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 8.0e-10 Identity = 34/91 (37.36%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of MELO3C025554.2 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-09 Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 0
BLAST of MELO3C025554.2 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.5e-08 Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 212.2 bits (539), Expect = 6.2e-52 Identity = 108/119 (90.76%), Postives = 113/119 (94.96%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 6.7e-38 Identity = 86/120 (71.67%), Postives = 101/120 (84.17%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 7.2e-16 Identity = 50/101 (49.50%), Postives = 69/101 (68.32%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TrEMBL
Match: tr|V4UQM2|V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina OX=85681 GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.6e-15 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 0
BLAST of MELO3C025554.2 vs. TrEMBL
Match: tr|A0A2H5PZ44|A0A2H5PZ44_CITUN (Cysteine proteinase inhibitor OS=Citrus unshiu OX=55188 GN=CUMW_180780 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 3.6e-15 Identity = 46/105 (43.81%), Postives = 68/105 (64.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|