MELO3C035602.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAAAGCTTCAACAATTCAAAGTCGGAATCGATATCACAAGATCTATCATTAGCAATATCTAATTCAACAATTGAAGATCCCTCAACAGTGACTATGGTGCTATTAGGATGCACTCGATGCCTCATGTACATCATGTCTTCTAAATTAGATCTTAAATGTCCTAAGTGTAACAACACTACGCTACTTGATATATTTAATTTGACCAATCAAGTATCTCGAGGAAATTTTGTCGATATGTCACCTGATGTTACTAAATGA ATGGGTCAAAGCTTCAACAATTCAAAGTCGGAATCGATATCACAAGATCTATCATTAGCAATATCTAATTCAACAATTGAAGATCCCTCAACAGTGACTATGGTGCTATTAGGATGCACTCGATGCCTCATGTACATCATGTCTTCTAAATTAGATCTTAAATGTCCTAAGTGTAACAACACTACGCTACTTGATATATTTAATTTGACCAATCAAGTATCTCGAGGAAATTTTGTCGATATGTCACCTGATGTTACTAAATGA ATGGGTCAAAGCTTCAACAATTCAAAGTCGGAATCGATATCACAAGATCTATCATTAGCAATATCTAATTCAACAATTGAAGATCCCTCAACAGTGACTATGGTGCTATTAGGATGCACTCGATGCCTCATGTACATCATGTCTTCTAAATTAGATCTTAAATGTCCTAAGTGTAACAACACTACGCTACTTGATATATTTAATTTGACCAATCAAGTATCTCGAGGAAATTTTGTCGATATGTCACCTGATGTTACTAAATGA MGQSFNNSKSESISQDLSLAISNSTIEDPSTVTMVLLGCTRCLMYIMSSKLDLKCPKCNNTTLLDIFNLTNQVSRGNFVDMSPDVTK
BLAST of MELO3C035602.2 vs. NCBI nr
Match: PNX88389.1 (hypothetical protein L195_g044492, partial [Trifolium pratense]) HSP 1 Score: 60.1 bits (144), Expect = 4.4e-06 Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of MELO3C035602.2 vs. NCBI nr
Match: GAU17469.1 (hypothetical protein TSUD_340120 [Trifolium subterraneum]) HSP 1 Score: 59.3 bits (142), Expect = 7.5e-06 Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 0
BLAST of MELO3C035602.2 vs. NCBI nr
Match: GAV66989.1 (hypothetical protein CFOL_v3_10498 [Cephalotus follicularis]) HSP 1 Score: 59.3 bits (142), Expect = 7.5e-06 Identity = 25/44 (56.82%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of MELO3C035602.2 vs. NCBI nr
Match: XP_022888450.1 (uncharacterized protein LOC111403986 [Olea europaea var. sylvestris]) HSP 1 Score: 59.3 bits (142), Expect = 7.5e-06 Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 0
BLAST of MELO3C035602.2 vs. NCBI nr
Match: PPD73206.1 (hypothetical protein GOBAR_DD29862 [Gossypium barbadense]) HSP 1 Score: 59.3 bits (142), Expect = 7.5e-06 Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TAIR10
Match: AT5G06270.1 (unknown protein) HSP 1 Score: 55.5 bits (132), Expect = 2.0e-08 Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TAIR10
Match: AT3G11600.1 (unknown protein) HSP 1 Score: 49.7 bits (117), Expect = 1.1e-06 Identity = 32/64 (50.00%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TrEMBL
Match: tr|A0A2K3MC92|A0A2K3MC92_TRIPR (Uncharacterized protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g044492 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.9e-06 Identity = 29/64 (45.31%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TrEMBL
Match: tr|W9SE60|W9SE60_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_018856 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 4.9e-06 Identity = 32/66 (48.48%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TrEMBL
Match: tr|A0A2P5QF74|A0A2P5QF74_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD29862 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 4.9e-06 Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TrEMBL
Match: tr|A0A1Q3BGG1|A0A1Q3BGG1_CEPFO (Uncharacterized protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_10498 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 4.9e-06 Identity = 25/44 (56.82%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of MELO3C035602.2 vs. TrEMBL
Match: tr|A0A072U397|A0A072U397_MEDTR (Uncharacterized protein OS=Medicago truncatula OX=3880 GN=25499448 PE=4 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 6.5e-06 Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|