ClCG01G011650 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA MGQSFNNLNSESISQDLSLAISNSTIEDATTVAMVLLGCTRCLMYVMSSKLDLKCPKCNGTTLLDVFNLVNQASRKNVVDMPPDVAK
BLAST of ClCG01G011650 vs. TrEMBL
Match: A0A0D2TG15_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G083300 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-07 Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 1
BLAST of ClCG01G011650 vs. TrEMBL
Match: A0A072UJ84_MEDTR (Uncharacterized protein OS=Medicago truncatula GN=MTR_4g052230 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.1e-07 Identity = 31/73 (42.47%), Postives = 42/73 (57.53%), Query Frame = 1
BLAST of ClCG01G011650 vs. TrEMBL
Match: B7FH31_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.4e-07 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 1
BLAST of ClCG01G011650 vs. TrEMBL
Match: A0A072U397_MEDTR (Uncharacterized protein OS=Medicago truncatula GN=MTR_7g105730 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.4e-07 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 1
BLAST of ClCG01G011650 vs. TrEMBL
Match: A0A0J8EU07_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_7g158450 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.0e-07 Identity = 31/68 (45.59%), Postives = 39/68 (57.35%), Query Frame = 1
BLAST of ClCG01G011650 vs. TAIR10
Match: AT3G11600.1 (AT3G11600.1 unknown protein) HSP 1 Score: 55.8 bits (133), Expect = 1.5e-08 Identity = 31/63 (49.21%), Postives = 36/63 (57.14%), Query Frame = 1
BLAST of ClCG01G011650 vs. TAIR10
Match: AT5G06270.1 (AT5G06270.1 unknown protein) HSP 1 Score: 54.3 bits (129), Expect = 4.4e-08 Identity = 24/35 (68.57%), Postives = 25/35 (71.43%), Query Frame = 1
BLAST of ClCG01G011650 vs. NCBI nr
Match: gi|763788583|gb|KJB55579.1| (hypothetical protein B456_009G083300 [Gossypium raimondii]) HSP 1 Score: 62.4 bits (150), Expect = 4.5e-07 Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 1
BLAST of ClCG01G011650 vs. NCBI nr
Match: gi|922367223|ref|XP_013455778.1| (hypothetical protein MTR_4g052230 [Medicago truncatula]) HSP 1 Score: 62.0 bits (149), Expect = 5.9e-07 Identity = 31/73 (42.47%), Postives = 42/73 (57.53%), Query Frame = 1
BLAST of ClCG01G011650 vs. NCBI nr
Match: gi|727583833|ref|XP_010464878.1| (PREDICTED: uncharacterized protein LOC104745369 [Camelina sativa]) HSP 1 Score: 62.0 bits (149), Expect = 5.9e-07 Identity = 33/66 (50.00%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of ClCG01G011650 vs. NCBI nr
Match: gi|217071400|gb|ACJ84060.1| (unknown [Medicago truncatula]) HSP 1 Score: 61.6 bits (148), Expect = 7.7e-07 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 1
BLAST of ClCG01G011650 vs. NCBI nr
Match: gi|922346510|ref|XP_013450169.1| (hypothetical protein MTR_7g105730 [Medicago truncatula]) HSP 1 Score: 61.6 bits (148), Expect = 7.7e-07 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|