Cla97C01G011280 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA ATGGGTCAAAGCTTCAACAATCTAAATTCAGAATCGATATCGCAAGATCTGTCGTTAGCTATATCTAACTCGACAATTGAAGATGCCACGACGGTGGCCATGGTGCTACTAGGATGCACTCGATGCCTCATGTACGTCATGTCGTCTAAGTTAGATCTCAAGTGTCCTAAATGTAACGGCACTACATTGCTTGATGTATTCAATTTGGTCAATCAAGCATCTCGAAAAAATGTTGTCGACATGCCGCCCGATGTTGCTAAATGA MGQSFNNLNSESISQDLSLAISNSTIEDATTVAMVLLGCTRCLMYVMSSKLDLKCPKCNGTTLLDVFNLVNQASRKNVVDMPPDVAK
BLAST of Cla97C01G011280 vs. NCBI nr
Match: XP_022888450.1 (uncharacterized protein LOC111403986 [Olea europaea var. sylvestris]) HSP 1 Score: 60.1 bits (144), Expect = 4.4e-06 Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of Cla97C01G011280 vs. NCBI nr
Match: PPD73206.1 (hypothetical protein GOBAR_DD29862 [Gossypium barbadense]) HSP 1 Score: 59.7 bits (143), Expect = 5.7e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280 vs. NCBI nr
Match: XP_004506211.1 (PREDICTED: uncharacterized protein LOC101502581 [Cicer arietinum]) HSP 1 Score: 59.3 bits (142), Expect = 7.5e-06 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 0
BLAST of Cla97C01G011280 vs. NCBI nr
Match: XP_017613487.1 (PREDICTED: uncharacterized protein LOC108458588 [Gossypium arboreum] >KHG14210.1 hypothetical protein F383_17358 [Gossypium arboreum]) HSP 1 Score: 58.5 bits (140), Expect = 1.3e-05 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Cla97C01G011280 vs. NCBI nr
Match: XP_016737864.1 (PREDICTED: uncharacterized protein LOC107947867 [Gossypium hirsutum]) HSP 1 Score: 58.5 bits (140), Expect = 1.3e-05 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TrEMBL
Match: tr|A0A2P5QF74|A0A2P5QF74_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD29862 PE=4 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 3.8e-06 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TrEMBL
Match: tr|A0A1S2YKZ1|A0A1S2YKZ1_CICAR (uncharacterized protein LOC101502581 OS=Cicer arietinum OX=3827 GN=LOC101502581 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 4.9e-06 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TrEMBL
Match: tr|A0A0B0NN04|A0A0B0NN04_GOSAR (Uncharacterized protein OS=Gossypium arboreum OX=29729 GN=F383_17358 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 8.4e-06 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TrEMBL
Match: tr|A0A1U8NJ13|A0A1U8NJ13_GOSHI (uncharacterized protein LOC107947867 OS=Gossypium hirsutum OX=3635 GN=LOC107947867 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 8.4e-06 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TrEMBL
Match: tr|A0A2P5SBS4|A0A2P5SBS4_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD06479 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 8.4e-06 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TAIR10
Match: AT5G06270.1 (unknown protein) HSP 1 Score: 52.4 bits (124), Expect = 1.7e-07 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 0
BLAST of Cla97C01G011280 vs. TAIR10
Match: AT3G11600.1 (unknown protein) HSP 1 Score: 50.4 bits (119), Expect = 6.3e-07 Identity = 31/63 (49.21%), Postives = 38/63 (60.32%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|