CsaV3_5G021950 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.CAAACCAAACACATTAAAACCTTCTTCTTCTCTTACACAAATGAGTCCATCGCCCTCCAAACCCAAAAGAAAGCACCACCCCCGCCCCCCGCAGAATCTACGCCCCACCGTTTCCTCGGAGTCCGTCGACGACCCTGGGGTCGATATGCCGCCGAGATCAGAGATCCTTCCACCAAAGAGCGTCATTGGCTCGGCACCTTCGACACCGCCGAGGACGCCGCCATTGCCTACGACCGTGCTGCCCGCTCCCTCCGCGGCTCCCTCGCTCGCACCAACTTCCTCTACTCCGACTCTCCGCCCCCTCCTCCCCCACTCTACTCTGCCTCCATTCACCACCCCAATCAGCCTCCTCTGTTTTCTTCCTCTGCTTCCACCCACTCCTCCCTCTCTTCTCCACCAATTCCCCCCGCCGGAGACTCCCTTTCCGGAATCATCTCCGGCGATTACGACGCCAGCGCTGAGCTTCCGCCATTTCTCCCGGCGATTTCCTCGGAATCGGTGGATTGTGATTATAATAATTACGGTGTGATGGAATCGCAGAACGTTGGATTTGAATGCTTTGATCAATCATCAATTGGAATCGGGTCGTGTTTGGGATTTGATTCGAGCAGTGATTATATATATAATCCGATGTTGGGTTCGATGCCGACGGTTTCCGACGTCGGCGCCGGTGATTTTGAGTCCCCGGCGGGTAATTTCTATTTGCCTCAGTCTTCAGATTACTGA CAAACCAAACACATTAAAACCTTCTTCTTCTCTTACACAAATGAGTCCATCGCCCTCCAAACCCAAAAGAAAGCACCACCCCCGCCCCCCGCAGAATCTACGCCCCACCGTTTCCTCGGAGTCCGTCGACGACCCTGGGGTCGATATGCCGCCGAGATCAGAGATCCTTCCACCAAAGAGCGTCATTGGCTCGGCACCTTCGACACCGCCGAGGACGCCGCCATTGCCTACGACCGTGCTGCCCGCTCCCTCCGCGGCTCCCTCGCTCGCACCAACTTCCTCTACTCCGACTCTCCGCCCCCTCCTCCCCCACTCTACTCTGCCTCCATTCACCACCCCAATCAGCCTCCTCTGTTTTCTTCCTCTGCTTCCACCCACTCCTCCCTCTCTTCTCCACCAATTCCCCCCGCCGGAGACTCCCTTTCCGGAATCATCTCCGGCGATTACGACGCCAGCGCTGAGCTTCCGCCATTTCTCCCGGCGATTTCCTCGGAATCGGTGGATTGTGATTATAATAATTACGGTGTGATGGAATCGCAGAACGTTGGATTTGAATGCTTTGATCAATCATCAATTGGAATCGGGTCGTGTTTGGGATTTGATTCGAGCAGTGATTATATATATAATCCGATGTTGGGTTCGATGCCGACGGTTTCCGACGTCGGCGCCGGTGATTTTGAGTCCCCGGCGGGTAATTTCTATTTGCCTCAGTCTTCAGATTACTGA CAAACCAAACACATTAAAACCTTCTTCTTCTCTTACACAAATGAGTCCATCGCCCTCCAAACCCAAAAGAAAGCACCACCCCCGCCCCCCGCAGAATCTACGCCCCACCGTTTCCTCGGAGTCCGTCGACGACCCTGGGGTCGATATGCCGCCGAGATCAGAGATCCTTCCACCAAAGAGCGTCATTGGCTCGGCACCTTCGACACCGCCGAGGACGCCGCCATTGCCTACGACCGTGCTGCCCGCTCCCTCCGCGGCTCCCTCGCTCGCACCAACTTCCTCTACTCCGACTCTCCGCCCCCTCCTCCCCCACTCTACTCTGCCTCCATTCACCACCCCAATCAGCCTCCTCTGTTTTCTTCCTCTGCTTCCACCCACTCCTCCCTCTCTTCTCCACCAATTCCCCCCGCCGGAGACTCCCTTTCCGGAATCATCTCCGGCGATTACGACGCCAGCGCTGAGCTTCCGCCATTTCTCCCGGCGATTTCCTCGGAATCGGTGGATTGTGATTATAATAATTACGGTGTGATGGAATCGCAGAACGTTGGATTTGAATGCTTTGATCAATCATCAATTGGAATCGGGTCGTGTTTGGGATTTGATTCGAGCAGTGATTATATATATAATCCGATGTTGGGTTCGATGCCGACGGTTTCCGACGTCGGCGCCGGTGATTTTGAGTCCCCGGCGGGTAATTTCTATTTGCCTCAGTCTTCAGATTACTGA QTKHIKTFFFSYTNESIALQTQKKAPPPPPAESTPHRFLGVRRRPWGRYAAEIRDPSTKERHWLGTFDTAEDAAIAYDRAARSLRGSLARTNFLYSDSPPPPPPLYSASIHHPNQPPLFSSSASTHSSLSSPPIPPAGDSLSGIISGDYDASAELPPFLPAISSESVDCDYNNYGVMESQNVGFECFDQSSIGIGSCLGFDSSSDYIYNPMLGSMPTVSDVGAGDFESPAGNFYLPQSSDY
BLAST of CsaV3_5G021950 vs. NCBI nr
Match: XP_004151396.1 (PREDICTED: ethylene-responsive transcription factor LEP-like [Cucumis sativus]) HSP 1 Score: 335.9 bits (860), Expect = 1.2e-88 Identity = 198/210 (94.29%), Postives = 198/210 (94.29%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. NCBI nr
Match: XP_008437672.1 (PREDICTED: ethylene-responsive transcription factor LEP [Cucumis melo]) HSP 1 Score: 294.3 bits (752), Expect = 3.8e-76 Identity = 186/211 (88.15%), Postives = 193/211 (91.47%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. NCBI nr
Match: XP_023541749.1 (ethylene-responsive transcription factor LEP-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 217.2 bits (552), Expect = 6.0e-53 Identity = 148/209 (70.81%), Postives = 159/209 (76.08%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. NCBI nr
Match: XP_022141682.1 (ethylene-responsive transcription factor LEP [Momordica charantia]) HSP 1 Score: 214.9 bits (546), Expect = 3.0e-52 Identity = 151/203 (74.38%), Postives = 166/203 (81.77%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. NCBI nr
Match: XP_022990620.1 (ethylene-responsive transcription factor LEP-like [Cucurbita maxima]) HSP 1 Score: 213.4 bits (542), Expect = 8.6e-52 Identity = 147/206 (71.36%), Postives = 156/206 (75.73%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TAIR10
Match: AT5G13910.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 120.6 bits (301), Expect = 1.4e-27 Identity = 104/188 (55.32%), Postives = 126/188 (67.02%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TAIR10
Match: AT5G18560.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 114.4 bits (285), Expect = 9.9e-26 Identity = 51/65 (78.46%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TAIR10
Match: AT1G28160.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 111.3 bits (277), Expect = 8.4e-25 Identity = 49/61 (80.33%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TAIR10
Match: AT1G12890.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 106.3 bits (264), Expect = 2.7e-23 Identity = 48/61 (78.69%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TAIR10
Match: AT1G12980.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 100.9 bits (250), Expect = 1.1e-21 Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. Swiss-Prot
Match: sp|Q9M644|LEP_ARATH (Ethylene-responsive transcription factor LEP OS=Arabidopsis thaliana OX=3702 GN=LEP PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 2.5e-26 Identity = 104/188 (55.32%), Postives = 126/188 (67.02%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. Swiss-Prot
Match: sp|Q6J9Q2|ERF86_ARATH (Ethylene-responsive transcription factor ERF086 OS=Arabidopsis thaliana OX=3702 GN=ERF086 PE=2 SV=2) HSP 1 Score: 114.4 bits (285), Expect = 1.8e-24 Identity = 51/65 (78.46%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. Swiss-Prot
Match: sp|Q8H3Q1|FZP_ORYSJ (Ethylene-responsive transcription factor FZP OS=Oryza sativa subsp. japonica OX=39947 GN=FZP PE=1 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 4.0e-24 Identity = 50/62 (80.65%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. Swiss-Prot
Match: sp|Q9FZ90|ERF87_ARATH (Ethylene-responsive transcription factor ERF087 OS=Arabidopsis thaliana OX=3702 GN=ERF087 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.5e-23 Identity = 49/61 (80.33%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. Swiss-Prot
Match: sp|Q3E703|ERF88_ARATH (Ethylene-responsive transcription factor ERF088 OS=Arabidopsis thaliana OX=3702 GN=ERF088 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 4.8e-22 Identity = 48/61 (78.69%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TrEMBL
Match: tr|A0A1S3AU89|A0A1S3AU89_CUCME (ethylene-responsive transcription factor LEP OS=Cucumis melo OX=3656 GN=LOC103483013 PE=4 SV=1) HSP 1 Score: 294.3 bits (752), Expect = 2.5e-76 Identity = 186/211 (88.15%), Postives = 193/211 (91.47%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TrEMBL
Match: tr|A0A2P6QZY6|A0A2P6QZY6_ROSCH (Putative transcription factor AP2-EREBP family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0428551 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 2.0e-28 Identity = 117/234 (50.00%), Postives = 135/234 (57.69%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TrEMBL
Match: tr|M5XK05|M5XK05_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G212700 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 2.2e-27 Identity = 91/236 (38.56%), Postives = 112/236 (47.46%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TrEMBL
Match: tr|A0A1U7ZQM3|A0A1U7ZQM3_NELNU (ethylene-responsive transcription factor LEP-like OS=Nelumbo nucifera OX=4432 GN=LOC104592717 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 4.9e-27 Identity = 88/227 (38.77%), Postives = 109/227 (48.02%), Query Frame = 0
BLAST of CsaV3_5G021950 vs. TrEMBL
Match: tr|A0A218X6G3|A0A218X6G3_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr019827 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 105/222 (47.30%), Postives = 128/222 (57.66%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|