Csa7G278200 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAGCAAAGAGCAAAAAATGAGGAGTTGAGTACGAATGTCAAAATTTGCATACATTTCTCAAACATCTCCTTTCTCCCCATATTAATAATATTTTTGGTTTCAAGCCCTAATAACTCCTCCATCTTAACTTCTAACTAAAATCTAATTTATTATCCCCCCCAATGGATAATAAAGCAGATCACAGAGCTCCAAGGCCAAACGATAGAAACAATCACAATAACAATCACAATCACAATCACCATCACCATCACAAAATGGCTTTCACAGACTTAAATTTAGAAGACCTTAAGCAGAATCCTCGCATCCTCGTCTCTCCTTCCCCACCATCCTCCATCGCCGCCAGGACTCCCTCCTCTGCTAAAGCCAATTGTCTCTGTTCTCCAACCACTCACATTGGCTCCTTCCGTTGCCGGCACCACCGGCATTCCGGTATGATCCGCGGCGGCTCCGTTGGCTCTAATCTCTCCGATTTGACCCGTAAACCTACCGAAATTGTGGGATCTTTTTCGCCTTGACTTCACTTGCCTTGCCTTTTTCCTTCTCTTTTCGAGGCGG ATGGATAATAAAGCAGATCACAGAGCTCCAAGGCCAAACGATAGAAACAATCACAATAACAATCACAATCACAATCACCATCACCATCACAAAATGGCTTTCACAGACTTAAATTTAGAAGACCTTAAGCAGAATCCTCGCATCCTCGTCTCTCCTTCCCCACCATCCTCCATCGCCGCCAGGACTCCCTCCTCTGCTAAAGCCAATTGTCTCTGTTCTCCAACCACTCACATTGGCTCCTTCCGTTGCCGGCACCACCGGCATTCCGGTATGATCCGCGGCGGCTCCGTTGGCTCTAATCTCTCCGATTTGACCCGTAAACCTACCGAAATTGTGGGATCTTTTTCGCCTTGA ATGGATAATAAAGCAGATCACAGAGCTCCAAGGCCAAACGATAGAAACAATCACAATAACAATCACAATCACAATCACCATCACCATCACAAAATGGCTTTCACAGACTTAAATTTAGAAGACCTTAAGCAGAATCCTCGCATCCTCGTCTCTCCTTCCCCACCATCCTCCATCGCCGCCAGGACTCCCTCCTCTGCTAAAGCCAATTGTCTCTGTTCTCCAACCACTCACATTGGCTCCTTCCGTTGCCGGCACCACCGGCATTCCGGTATGATCCGCGGCGGCTCCGTTGGCTCTAATCTCTCCGATTTGACCCGTAAACCTACCGAAATTGTGGGATCTTTTTCGCCTTGA MDNKADHRAPRPNDRNNHNNNHNHNHHHHHKMAFTDLNLEDLKQNPRILVSPSPPSSIAARTPSSAKANCLCSPTTHIGSFRCRHHRHSGMIRGGSVGSNLSDLTRKPTEIVGSFSP*
BLAST of Csa7G278200 vs. TrEMBL
Match: A0A0A0K3W3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G278200 PE=4 SV=1) HSP 1 Score: 254.2 bits (648), Expect = 7.7e-65 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa7G278200 vs. TrEMBL
Match: W9SBP1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_020205 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 55/114 (48.25%), Postives = 68/114 (59.65%), Query Frame = 1
BLAST of Csa7G278200 vs. TrEMBL
Match: A0A0A0L7C7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G045050 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 7.3e-15 Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 1
BLAST of Csa7G278200 vs. TrEMBL
Match: A0A072UXD4_MEDTR (PGPS/D10 protein, putative OS=Medicago truncatula GN=MTR_3g461010 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.8e-14 Identity = 46/77 (59.74%), Postives = 54/77 (70.13%), Query Frame = 1
BLAST of Csa7G278200 vs. TrEMBL
Match: A0A0B2PP39_GLYSO (Uncharacterized protein (Fragment) OS=Glycine soja GN=glysoja_039434 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.4e-13 Identity = 44/84 (52.38%), Postives = 52/84 (61.90%), Query Frame = 1
BLAST of Csa7G278200 vs. TAIR10
Match: AT5G55980.1 (AT5G55980.1 serine-rich protein-related) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-10 Identity = 26/40 (65.00%), Postives = 29/40 (72.50%), Query Frame = 1
BLAST of Csa7G278200 vs. TAIR10
Match: AT3G13227.1 (AT3G13227.1 serine-rich protein-related) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-10 Identity = 35/79 (44.30%), Postives = 44/79 (55.70%), Query Frame = 1
BLAST of Csa7G278200 vs. TAIR10
Match: AT5G20370.1 (AT5G20370.1 serine-rich protein-related) HSP 1 Score: 55.1 bits (131), Expect = 3.5e-08 Identity = 29/78 (37.18%), Postives = 36/78 (46.15%), Query Frame = 1
BLAST of Csa7G278200 vs. TAIR10
Match: AT1G67910.1 (AT1G67910.1 unknown protein) HSP 1 Score: 51.6 bits (122), Expect = 3.8e-07 Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 1
BLAST of Csa7G278200 vs. TAIR10
Match: AT5G25280.1 (AT5G25280.1 serine-rich protein-related) HSP 1 Score: 51.2 bits (121), Expect = 5.0e-07 Identity = 31/95 (32.63%), Postives = 48/95 (50.53%), Query Frame = 1
BLAST of Csa7G278200 vs. NCBI nr
Match: gi|700189152|gb|KGN44385.1| (hypothetical protein Csa_7G278200 [Cucumis sativus]) HSP 1 Score: 254.2 bits (648), Expect = 1.1e-64 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa7G278200 vs. NCBI nr
Match: gi|659126143|ref|XP_008463032.1| (PREDICTED: dual specificity tyrosine-phosphorylation-regulated kinase 1A [Cucumis melo]) HSP 1 Score: 201.8 bits (512), Expect = 6.5e-49 Identity = 96/122 (78.69%), Postives = 107/122 (87.70%), Query Frame = 1
BLAST of Csa7G278200 vs. NCBI nr
Match: gi|703127862|ref|XP_010103953.1| (hypothetical protein L484_020205 [Morus notabilis]) HSP 1 Score: 103.6 bits (257), Expect = 2.4e-19 Identity = 55/114 (48.25%), Postives = 68/114 (59.65%), Query Frame = 1
BLAST of Csa7G278200 vs. NCBI nr
Match: gi|700200858|gb|KGN55991.1| (hypothetical protein Csa_3G045050 [Cucumis sativus]) HSP 1 Score: 88.2 bits (217), Expect = 1.0e-14 Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 1
BLAST of Csa7G278200 vs. NCBI nr
Match: gi|922379672|ref|XP_013460070.1| (PGPS/D10 protein, putative [Medicago truncatula]) HSP 1 Score: 86.3 bits (212), Expect = 4.0e-14 Identity = 46/77 (59.74%), Postives = 54/77 (70.13%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|