Csa5G190490 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAAATGGGGAAAGTTATTTCTTGCCACACTGTATCCTCATGGAAGCAGCACCTACTCAAAGCCGAACAATGCAACAAGCTGGTATATATATCTCTACTTTTTCTTTAGTTTTCAAGATCAAATCCTAAATTTTGAAACTAAACACTCGTTTGACAATCTTAATTAGTTTGTTGGTCTTTGAAGTACAGTTTTATAATACCACTAAAAAAACACTTATTTTCTCTGTCAAATTCTAAAAACAAAAACCAGTATTTAAAAGGAAAATTTTAAAACATACTAAATTTTACAAAATATTTACAATATACAGCAAATTCTTTTGCTATTTTTAAAAATACCCCTATTTAAAAACTAGTATTTTCAATAATTTATGGTTTTCATTTTAAATATTTGGGTAAGAATTCAAGTATTTCCTCCAAAAATGTATAAATCATACTGTAAAAAGCATAATTTTTTAAGAAAAAATAAATTTAAAACATATAATTACCAAAGGTAACCAATATGGTCCACTTTCACATTTAAGTTAAAAATAATAAAATACATAGCACAAGCATAAAATTATAGAATTAGTAAAAGACTAAAAAATTCACATGCGGTGTTATTTTTTCAAGTATTTTATTTTTTACTATATTTTTAGTTTAATTCTTAAATTGTGCTCTTAAAAATTATTATGAAAACGAGACTGTAGCTAACAATGCACTATTGTAATTGGTAGGTGGTTGTGAACTTCACAGCTTCATGGTGTGGCCCATGTCGTTTCATGGCTCCAATTCTTGAAGAGTTGGCAAAGAAAATGAGTAATAATGTTATATTCTTGAAAGTTGATATTGATGAACTTATGGTGAGTTAAAAAGAAATTATTATTATTATTCGATCATATATATATGCTTTTGCTGATGCAACTTTTGTTAATTAAAATTGTGATTTAATTTAATTTTGTACTGTGTTTTACAGAGTATTGCAAAGGAGTTTGGAGTCAGTTCCGTTCCTTCATTTCAATTCTTAAAGAATGGAAAATTGGTGGACAAGTTCGTGGGTGCAAAGAAAACTTTACTCCAAAACACTATTTCCAAACATTCAGCCTATTGAAGAAAA ATGGCAGAAATGGGGAAAGTTATTTCTTGCCACACTGTATCCTCATGGAAGCAGCACCTACTCAAAGCCGAACAATGCAACAAGCTGGTGGTTGTGAACTTCACAGCTTCATGGTGTGGCCCATGTCGTTTCATGGCTCCAATTCTTGAAGAGTTGGCAAAGAAAATGAGTAATAATGTTATATTCTTGAAAGTTGATATTGATGAACTTATGAGTATTGCAAAGGAGTTTGGAGTCAGTTCCGTTCCTTCATTTCAATTCTTAAAGAATGGAAAATTGGTGGACAAGTTCGTGGGTGCAAAGAAAACTTTACTCCAAAACACTATTTCCAAACATTCAGCCTATTGA ATGGCAGAAATGGGGAAAGTTATTTCTTGCCACACTGTATCCTCATGGAAGCAGCACCTACTCAAAGCCGAACAATGCAACAAGCTGGTGGTTGTGAACTTCACAGCTTCATGGTGTGGCCCATGTCGTTTCATGGCTCCAATTCTTGAAGAGTTGGCAAAGAAAATGAGTAATAATGTTATATTCTTGAAAGTTGATATTGATGAACTTATGAGTATTGCAAAGGAGTTTGGAGTCAGTTCCGTTCCTTCATTTCAATTCTTAAAGAATGGAAAATTGGTGGACAAGTTCGTGGGTGCAAAGAAAACTTTACTCCAAAACACTATTTCCAAACATTCAGCCTATTGA MAEMGKVISCHTVSSWKQHLLKAEQCNKLVVVNFTASWCGPCRFMAPILEELAKKMSNNVIFLKVDIDELMSIAKEFGVSSVPSFQFLKNGKLVDKFVGAKKTLLQNTISKHSAY*
BLAST of Csa5G190490 vs. Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 9.9e-34 Identity = 69/113 (61.06%), Postives = 83/113 (73.45%), Query Frame = 1
BLAST of Csa5G190490 vs. Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.8e-33 Identity = 66/113 (58.41%), Postives = 86/113 (76.11%), Query Frame = 1
BLAST of Csa5G190490 vs. Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 9.3e-32 Identity = 67/112 (59.82%), Postives = 82/112 (73.21%), Query Frame = 1
BLAST of Csa5G190490 vs. Swiss-Prot
Match: TRXH4_ARATH (Thioredoxin H4 OS=Arabidopsis thaliana GN=TRX4 PE=3 SV=2) HSP 1 Score: 136.7 bits (343), Expect = 1.6e-31 Identity = 64/112 (57.14%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Csa5G190490 vs. Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.7e-31 Identity = 64/113 (56.64%), Postives = 85/113 (75.22%), Query Frame = 1
BLAST of Csa5G190490 vs. TrEMBL
Match: A0A0A0KLS7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G190490 PE=4 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 1.4e-58 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 1
BLAST of Csa5G190490 vs. TrEMBL
Match: A0A0A0KSB1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G190500 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 1.1e-44 Identity = 86/114 (75.44%), Postives = 100/114 (87.72%), Query Frame = 1
BLAST of Csa5G190490 vs. TrEMBL
Match: A0A0A0KLR8_CUCSA (Thioredoxin H-type OS=Cucumis sativus GN=Csa_5G189900 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 7.1e-39 Identity = 80/113 (70.80%), Postives = 98/113 (86.73%), Query Frame = 1
BLAST of Csa5G190490 vs. TrEMBL
Match: A0A0A0LGF7_CUCSA (Thioredoxin OS=Cucumis sativus GN=Csa_3G865340 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.8e-34 Identity = 71/113 (62.83%), Postives = 94/113 (83.19%), Query Frame = 1
BLAST of Csa5G190490 vs. TrEMBL
Match: A0A0B2QL73_GLYSO (Thioredoxin H-type OS=Glycine soja GN=glysoja_021976 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.4e-34 Identity = 73/114 (64.04%), Postives = 92/114 (80.70%), Query Frame = 1
BLAST of Csa5G190490 vs. TAIR10
Match: AT3G51030.1 (AT3G51030.1 thioredoxin H-type 1) HSP 1 Score: 142.1 bits (357), Expect = 2.1e-34 Identity = 66/113 (58.41%), Postives = 86/113 (76.11%), Query Frame = 1
BLAST of Csa5G190490 vs. TAIR10
Match: AT1G19730.1 (AT1G19730.1 Thioredoxin superfamily protein) HSP 1 Score: 136.7 bits (343), Expect = 8.9e-33 Identity = 64/112 (57.14%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Csa5G190490 vs. TAIR10
Match: AT1G45145.1 (AT1G45145.1 thioredoxin H-type 5) HSP 1 Score: 124.8 bits (312), Expect = 3.5e-29 Identity = 53/112 (47.32%), Postives = 80/112 (71.43%), Query Frame = 1
BLAST of Csa5G190490 vs. TAIR10
Match: AT5G42980.1 (AT5G42980.1 thioredoxin 3) HSP 1 Score: 116.3 bits (290), Expect = 1.2e-26 Identity = 53/112 (47.32%), Postives = 78/112 (69.64%), Query Frame = 1
BLAST of Csa5G190490 vs. TAIR10
Match: AT3G17880.1 (AT3G17880.1 tetraticopeptide domain-containing thioredoxin) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-23 Identity = 50/110 (45.45%), Postives = 76/110 (69.09%), Query Frame = 1
BLAST of Csa5G190490 vs. NCBI nr
Match: gi|449464454|ref|XP_004149944.1| (PREDICTED: thioredoxin H-type-like [Cucumis sativus]) HSP 1 Score: 233.4 bits (594), Expect = 2.0e-58 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 1
BLAST of Csa5G190490 vs. NCBI nr
Match: gi|659129894|ref|XP_008464899.1| (PREDICTED: thioredoxin H-type-like [Cucumis melo]) HSP 1 Score: 222.6 bits (566), Expect = 3.5e-55 Identity = 111/114 (97.37%), Postives = 112/114 (98.25%), Query Frame = 1
BLAST of Csa5G190490 vs. NCBI nr
Match: gi|449464452|ref|XP_004149943.1| (PREDICTED: thioredoxin H1-like [Cucumis sativus]) HSP 1 Score: 187.2 bits (474), Expect = 1.6e-44 Identity = 86/114 (75.44%), Postives = 100/114 (87.72%), Query Frame = 1
BLAST of Csa5G190490 vs. NCBI nr
Match: gi|659129896|ref|XP_008464900.1| (PREDICTED: thioredoxin H1-like [Cucumis melo]) HSP 1 Score: 181.0 bits (458), Expect = 1.2e-42 Identity = 84/114 (73.68%), Postives = 99/114 (86.84%), Query Frame = 1
BLAST of Csa5G190490 vs. NCBI nr
Match: gi|659129892|ref|XP_008464898.1| (PREDICTED: thioredoxin H1-like [Cucumis melo]) HSP 1 Score: 168.7 bits (426), Expect = 6.0e-39 Identity = 80/113 (70.80%), Postives = 100/113 (88.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |