Csa4G607030 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAAATAAATTCTCTATTGAGAAAATGCAAAAGCCTTTCAAGGCAATTGGGAAGATCTTCATCATACAGCAGCTTGAGATCAAAGTCCACAAGAGAAGATCTTTGGGTTTGTGAAAAACAAGAAGAAGACTTTGAGCAACAAATTGAGCAAAAGGTGAGTGGCAGTAATGTAATTTTATATGTTGGAAGTACAAGAAAGAAATATGCAATAAATTCAAAATATTTGAGCCATCCTTTGTTAAATGCTCTTATTGATAAATCCAAGTCTAAGAAATTAGTTGATGATGATGATGATGATGATGATGGACATGAAGATGATGAAGAATGTATTTTAGTGAGATGTGAAGTTGTTTTATTTGATCATCTTCTGTGGATGTTGGAAAATTCAGATCCAAATATTACTTTTGATTCTAATTTGGAGGAATTGGCTGAACTTTATGTTTTTTAG ATGAAAAAAATAAATTCTCTATTGAGAAAATGCAAAAGCCTTTCAAGGCAATTGGGAAGATCTTCATCATACAGCAGCTTGAGATCAAAGTCCACAAGAGAAGATCTTTGGGTTTGTGAAAAACAAGAAGAAGACTTTGAGCAACAAATTGAGCAAAAGGTGAGTGGCAGTAATGTAATTTTATATGTTGGAATTGTTTTATTTGATCATCTTCTGTGGATGTTGGAAAATTCAGATCCAAATATTACTTTTGATTCTAATTTGGAGGAATTGGCTGAACTTTATGTTTTTTAG ATGAAAAAAATAAATTCTCTATTGAGAAAATGCAAAAGCCTTTCAAGGCAATTGGGAAGATCTTCATCATACAGCAGCTTGAGATCAAAGTCCACAAGAGAAGATCTTTGGGTTTGTGAAAAACAAGAAGAAGACTTTGAGCAACAAATTGAGCAAAAGGTGAGTGGCAGTAATGTAATTTTATATGTTGGAATTGTTTTATTTGATCATCTTCTGTGGATGTTGGAAAATTCAGATCCAAATATTACTTTTGATTCTAATTTGGAGGAATTGGCTGAACTTTATGTTTTTTAG MKKINSLLRKCKSLSRQLGRSSSYSSLRSKSTREDLWVCEKQEEDFEQQIEQKVSGSNVILYVGIVLFDHLLWMLENSDPNITFDSNLEELAELYVF*
BLAST of Csa4G607030 vs. TrEMBL
Match: A0A0A0L464_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G607030 PE=4 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 6.0e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa4G607030 vs. TrEMBL
Match: B9RI47_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1576420 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.5e-23 Identity = 66/126 (52.38%), Postives = 80/126 (63.49%), Query Frame = 1
BLAST of Csa4G607030 vs. TrEMBL
Match: B9I0J2_POPTR (Auxin-responsive family protein OS=Populus trichocarpa GN=POPTR_0011s14660g PE=4 SV=2) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-21 Identity = 66/126 (52.38%), Postives = 79/126 (62.70%), Query Frame = 1
BLAST of Csa4G607030 vs. TrEMBL
Match: V7AKJ2_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_011G174700g PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 7.4e-21 Identity = 66/128 (51.56%), Postives = 77/128 (60.16%), Query Frame = 1
BLAST of Csa4G607030 vs. TrEMBL
Match: A0A151UFN6_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_048986 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.3e-20 Identity = 65/127 (51.18%), Postives = 75/127 (59.06%), Query Frame = 1
BLAST of Csa4G607030 vs. TAIR10
Match: AT3G12955.1 (AT3G12955.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 52.8 bits (125), Expect = 1.4e-07 Identity = 41/133 (30.83%), Postives = 60/133 (45.11%), Query Frame = 1
BLAST of Csa4G607030 vs. NCBI nr
Match: gi|700199768|gb|KGN54926.1| (hypothetical protein Csa_4G607030 [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 8.6e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa4G607030 vs. NCBI nr
Match: gi|778695308|ref|XP_011653970.1| (PREDICTED: uncharacterized protein LOC105435277 [Cucumis sativus]) HSP 1 Score: 127.9 bits (320), Expect = 9.9e-27 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 1
BLAST of Csa4G607030 vs. NCBI nr
Match: gi|778695308|ref|XP_011653970.1| (PREDICTED: uncharacterized protein LOC105435277 [Cucumis sativus]) HSP 1 Score: 71.2 bits (173), Expect = 1.1e-09 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
HSP 2 Score: 119.0 bits (297), Expect = 4.6e-24 Identity = 60/65 (92.31%), Postives = 63/65 (96.92%), Query Frame = 1
BLAST of Csa4G607030 vs. NCBI nr
Match: gi|659087142|ref|XP_008444291.1| (PREDICTED: uncharacterized protein LOC103487659 [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 9.0e-20 Identity = 70/153 (45.75%), Postives = 81/153 (52.94%), Query Frame = 1
HSP 2 Score: 115.5 bits (288), Expect = 5.1e-23 Identity = 66/126 (52.38%), Postives = 80/126 (63.49%), Query Frame = 1
BLAST of Csa4G607030 vs. NCBI nr
Match: gi|566195513|ref|XP_002317621.2| (auxin-responsive family protein [Populus trichocarpa]) HSP 1 Score: 110.5 bits (275), Expect = 1.6e-21 Identity = 66/126 (52.38%), Postives = 79/126 (62.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|