Csa3G874410 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTTCTCCCATGATTTACGTGAATTTATTCTTCGAGCAAGAGTGTTGAAACTGTATAGACAGGGTTTAAGAACAGCTCGGAAAGCGCCTGTTGATGGTCGAGGTAAAGCTGTGTTTATTAATGGGATTTTGTAATGACTTTGTGTTGTGATTATTGAAATTTCATCTAATTGGATTAGATGGTAACAGATGAATTGAGGCATATGATGAGAGAAGAAATGGAGAAGAACAGAAAGTGTAATGATAGACAGAAAATAAGATTTTTGTTGAGCGAAGGAATAGAGCGATTGAAGCGTCTAGATGAGATGTTGGATATGCAAGGCCATTAG ATGGTTTTCTCCCATGATTTACGTGAATTTATTCTTCGAGCAAGAGTGTTGAAACTGTATAGACAGGATGAATTGAGGCATATGATGAGAGAAGAAATGGAGAAGAACAGAAAGTGTAATGATAGACAGAAAATAAGATTTTTGTTGAGCGAAGGAATAGAGCGATTGAAGCGTCTAGATGAGATGTTGGATATGCAAGGCCATTAG ATGGTTTTCTCCCATGATTTACGTGAATTTATTCTTCGAGCAAGAGTGTTGAAACTGTATAGACAGGATGAATTGAGGCATATGATGAGAGAAGAAATGGAGAAGAACAGAAAGTGTAATGATAGACAGAAAATAAGATTTTTGTTGAGCGAAGGAATAGAGCGATTGAAGCGTCTAGATGAGATGTTGGATATGCAAGGCCATTAG MVFSHDLREFILRARVLKLYRQDELRHMMREEMEKNRKCNDRQKIRFLLSEGIERLKRLDEMLDMQGH*
BLAST of Csa3G874410 vs. TrEMBL
Match: A0A0A0LGK2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G874410 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 2.1e-30 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Csa3G874410 vs. TrEMBL
Match: A0A151RQG9_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_033710 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.4e-18 Identity = 49/76 (64.47%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Csa3G874410 vs. TrEMBL
Match: A9P9V6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s17970g PE=2 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 9.2e-18 Identity = 50/81 (61.73%), Postives = 60/81 (74.07%), Query Frame = 1
BLAST of Csa3G874410 vs. TrEMBL
Match: M5XJM7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024578mg PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 9.2e-18 Identity = 50/81 (61.73%), Postives = 59/81 (72.84%), Query Frame = 1
BLAST of Csa3G874410 vs. TrEMBL
Match: W9RMC8_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_014312 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.5e-17 Identity = 50/81 (61.73%), Postives = 57/81 (70.37%), Query Frame = 1
BLAST of Csa3G874410 vs. TAIR10
Match: AT1G76065.1 (AT1G76065.1 LYR family of Fe/S cluster biogenesis protein) HSP 1 Score: 94.4 bits (233), Expect = 3.0e-20 Identity = 48/76 (63.16%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Csa3G874410 vs. NCBI nr
Match: gi|700204931|gb|KGN60064.1| (hypothetical protein Csa_3G874410 [Cucumis sativus]) HSP 1 Score: 139.0 bits (349), Expect = 3.0e-30 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Csa3G874410 vs. NCBI nr
Match: gi|449437174|ref|XP_004136367.1| (PREDICTED: LYR motif-containing protein 2 [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 1.8e-27 Identity = 68/81 (83.95%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of Csa3G874410 vs. NCBI nr
Match: gi|659132917|ref|XP_008466455.1| (PREDICTED: uncharacterized protein LOC103503854 [Cucumis melo]) HSP 1 Score: 128.3 bits (321), Expect = 5.3e-27 Identity = 67/81 (82.72%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of Csa3G874410 vs. NCBI nr
Match: gi|1012333396|gb|KYP44791.1| (hypothetical protein KK1_033710 [Cajanus cajan]) HSP 1 Score: 99.0 bits (245), Expect = 3.5e-18 Identity = 49/76 (64.47%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Csa3G874410 vs. NCBI nr
Match: gi|645228886|ref|XP_008221204.1| (PREDICTED: uncharacterized protein LOC103321195 [Prunus mume]) HSP 1 Score: 97.1 bits (240), Expect = 1.3e-17 Identity = 50/81 (61.73%), Postives = 59/81 (72.84%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|