Csa1G448940 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTATCAGATATTGCGAAGAATCACCAAGTGAGGAAGAAGTACACTATTCAGCTGGGTGAGAACGAGCTCGTTCTTAAGGTTTCCCCACCCTTCTCACTTGTTTCCTCGTAGATTGAAGTATTTGCTTGTGTACAGTTCAGTAGCGAGGAGGGGAAGTAGGCTAAGAGACTTTTTCTGACTCGTGTATTTCTGTCCACACAGAAGTTGTAAAAAATAGAATTTCATTTTTTCGTTTCAATTTATACGTTCGTGCGTTTCAAGGGGATTTTTCTTCACTTGATTCGATATGTGGTTTAGATAATGGAAATTTCTTTACATTTATATAATCTGGCATACGATAAGAATTGAAGCATTCTTATCAGTGGACATTTTTCTCGTTTATTGCTACTACGTGTGAGCTTGTTTCTTGATCTGCTTCTTTACTTACCTATGCAGGAATTGGATTTACTTCAAGACGACACAAATGTATATAAACTGATTGGTCCAGTGCTCGTGAAGCAAGATTTGGCAGAAGCAAATGCGAATGTGCGCAAGAGAATTGAATACATCTCCGCAGAATTGTGTGTTTCTTCATCTGTTTTCCATATAGTTTTTTAG ATGGATTTATCAGATATTGCGAAGAATCACCAAGTGAGGAAGAAGTACACTATTCAGCTGGGTGAGAACGAGCTCGTTCTTAAGGAATTGGATTTACTTCAAGACGACACAAATGTATATAAACTGATTGGTCCAGTGCTCGTGAAGCAAGATTTGGCAGAAGCAAATGCGAATGTGCGCAAGAGAATTGAATACATCTCCGCAGAATTGTGTGTTTCTTCATCTGTTTTCCATATAGTTTTTTAG ATGGATTTATCAGATATTGCGAAGAATCACCAAGTGAGGAAGAAGTACACTATTCAGCTGGGTGAGAACGAGCTCGTTCTTAAGGAATTGGATTTACTTCAAGACGACACAAATGTATATAAACTGATTGGTCCAGTGCTCGTGAAGCAAGATTTGGCAGAAGCAAATGCGAATGTGCGCAAGAGAATTGAATACATCTCCGCAGAATTGTGTGTTTCTTCATCTGTTTTCCATATAGTTTTTTAG MDLSDIAKNHQVRKKYTIQLGENELVLKELDLLQDDTNVYKLIGPVLVKQDLAEANANVRKRIEYISAELCVSSSVFHIVF*
BLAST of Csa1G448940 vs. Swiss-Prot
Match: PFD6_DROME (Probable prefoldin subunit 6 OS=Drosophila melanogaster GN=CG7770 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 35/52 (67.31%), Postives = 37/52 (71.15%), Query Frame = 1
BLAST of Csa1G448940 vs. Swiss-Prot
Match: PFD6_HUMAN (Prefoldin subunit 6 OS=Homo sapiens GN=PFDN6 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of Csa1G448940 vs. Swiss-Prot
Match: PFD6_MOUSE (Prefoldin subunit 6 OS=Mus musculus GN=Pfdn6 PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of Csa1G448940 vs. Swiss-Prot
Match: PFD6_BOVIN (Prefoldin subunit 6 OS=Bos taurus GN=PFDN6 PE=2 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of Csa1G448940 vs. Swiss-Prot
Match: PFD6_CANLF (Prefoldin subunit 6 OS=Canis lupus familiaris GN=PFDN6 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-11 Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of Csa1G448940 vs. TrEMBL
Match: A0A0A0LUZ0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G448940 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 1.8e-36 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. TrEMBL
Match: W9SEQ9_9ROSA (Prefoldin subunit 6 OS=Morus notabilis GN=L484_021677 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 2.9e-26 Identity = 63/68 (92.65%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Csa1G448940 vs. TrEMBL
Match: I1LNU5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_12G006600 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.7e-26 Identity = 62/66 (93.94%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. TrEMBL
Match: A0A0D3D5V3_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.7e-26 Identity = 63/68 (92.65%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Csa1G448940 vs. TrEMBL
Match: K7LSA3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_12G006600 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.7e-26 Identity = 62/66 (93.94%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. TAIR10
Match: AT1G29990.1 (AT1G29990.1 prefoldin 6) HSP 1 Score: 122.9 bits (307), Expect = 9.4e-29 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 1
BLAST of Csa1G448940 vs. NCBI nr
Match: gi|700210467|gb|KGN65563.1| (hypothetical protein Csa_1G448940 [Cucumis sativus]) HSP 1 Score: 159.5 bits (402), Expect = 2.6e-36 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. NCBI nr
Match: gi|449459354|ref|XP_004147411.1| (PREDICTED: prefoldin subunit 6 [Cucumis sativus]) HSP 1 Score: 130.2 bits (326), Expect = 1.7e-27 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. NCBI nr
Match: gi|659068358|ref|XP_008444032.1| (PREDICTED: prefoldin subunit 6 [Cucumis melo]) HSP 1 Score: 129.8 bits (325), Expect = 2.2e-27 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa1G448940 vs. NCBI nr
Match: gi|703154598|ref|XP_010110983.1| (Prefoldin subunit 6 [Morus notabilis]) HSP 1 Score: 125.6 bits (314), Expect = 4.1e-26 Identity = 63/68 (92.65%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Csa1G448940 vs. NCBI nr
Match: gi|823248881|ref|XP_012457094.1| (PREDICTED: prefoldin subunit 6-like [Gossypium raimondii]) HSP 1 Score: 125.2 bits (313), Expect = 5.4e-26 Identity = 63/66 (95.45%), Postives = 65/66 (98.48%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|