Csa1G025180 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTCCGCTGAGATTTATTCTCATATTTCTCTCAGCGACGCTTGCCGGATTCTTCGTTCTCCGCAACCTCAAATCTCAGCCTCAAGATTTCGTGGCCGGCGATAATTCAGACGATAACTCCAACGAATTCGATTCCTCCGATTCGTCCTCCTGCTCCAAGGTTCTTCTAATTGTTCTTCACCGGAATCTTGCATTTTCTTTTTCTTTGTTTGTGTCTGAATGGAATTATTGTGGTGGTTTGTTTGAACAGGTGTCTTCGGGGTTCTGGACGTTGGTGGATATGGCCAGCGGCCGCTACTTGTGGAGGCATTTGTTTCCATCGTCGAAGAAGCCTTCCGATTGA ATGTGTCCGCTGAGATTTATTCTCATATTTCTCTCAGCGACGCTTGCCGGATTCTTCGTTCTCCGCAACCTCAAATCTCAGCCTCAAGATTTCGTGGCCGGCGATAATTCAGACGATAACTCCAACGAATTCGATTCCTCCGATTCGTCCTCCTGCTCCAAGGTGTCTTCGGGGTTCTGGACGTTGGTGGATATGGCCAGCGGCCGCTACTTGTGGAGGCATTTGTTTCCATCGTCGAAGAAGCCTTCCGATTGA ATGTGTCCGCTGAGATTTATTCTCATATTTCTCTCAGCGACGCTTGCCGGATTCTTCGTTCTCCGCAACCTCAAATCTCAGCCTCAAGATTTCGTGGCCGGCGATAATTCAGACGATAACTCCAACGAATTCGATTCCTCCGATTCGTCCTCCTGCTCCAAGGTGTCTTCGGGGTTCTGGACGTTGGTGGATATGGCCAGCGGCCGCTACTTGTGGAGGCATTTGTTTCCATCGTCGAAGAAGCCTTCCGATTGA MCPLRFILIFLSATLAGFFVLRNLKSQPQDFVAGDNSDDNSNEFDSSDSSSCSKVSSGFWTLVDMASGRYLWRHLFPSSKKPSD*
BLAST of Csa1G025180 vs. TrEMBL
Match: A0A0A0LV42_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G025180 PE=4 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 4.3e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa1G025180 vs. TrEMBL
Match: I3T9P9_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.9e-21 Identity = 58/92 (63.04%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of Csa1G025180 vs. TrEMBL
Match: A0A0A0LVB2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G533620 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.8e-21 Identity = 56/86 (65.12%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of Csa1G025180 vs. TrEMBL
Match: D7SJL0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0004g07850 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-20 Identity = 59/88 (67.05%), Postives = 64/88 (72.73%), Query Frame = 1
BLAST of Csa1G025180 vs. TrEMBL
Match: W9SAE2_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_010690 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.4e-20 Identity = 57/94 (60.64%), Postives = 66/94 (70.21%), Query Frame = 1
BLAST of Csa1G025180 vs. TAIR10
Match: AT5G58375.1 (AT5G58375.1 Methyltransferase-related protein) HSP 1 Score: 84.7 bits (208), Expect = 2.9e-17 Identity = 48/87 (55.17%), Postives = 55/87 (63.22%), Query Frame = 1
BLAST of Csa1G025180 vs. TAIR10
Match: AT5G18150.1 (AT5G18150.1 Methyltransferase-related protein) HSP 1 Score: 71.2 bits (173), Expect = 3.4e-13 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 1
BLAST of Csa1G025180 vs. TAIR10
Match: AT5G14602.1 (AT5G14602.1 FUNCTIONS IN: molecular_function unknown) HSP 1 Score: 67.8 bits (164), Expect = 3.7e-12 Identity = 35/75 (46.67%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Csa1G025180 vs. NCBI nr
Match: gi|700208790|gb|KGN63886.1| (hypothetical protein Csa_1G025180 [Cucumis sativus]) HSP 1 Score: 174.9 bits (442), Expect = 6.1e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa1G025180 vs. NCBI nr
Match: gi|659107022|ref|XP_008453499.1| (PREDICTED: uncharacterized protein LOC103494193 [Cucumis melo]) HSP 1 Score: 166.0 bits (419), Expect = 2.8e-38 Identity = 79/84 (94.05%), Postives = 82/84 (97.62%), Query Frame = 1
BLAST of Csa1G025180 vs. NCBI nr
Match: gi|388522359|gb|AFK49241.1| (unknown [Lotus japonicus]) HSP 1 Score: 109.0 bits (271), Expect = 4.1e-21 Identity = 58/92 (63.04%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of Csa1G025180 vs. NCBI nr
Match: gi|700210759|gb|KGN65855.1| (hypothetical protein Csa_1G533620 [Cucumis sativus]) HSP 1 Score: 108.6 bits (270), Expect = 5.4e-21 Identity = 56/86 (65.12%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of Csa1G025180 vs. NCBI nr
Match: gi|297745780|emb|CBI15836.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 59/88 (67.05%), Postives = 64/88 (72.73%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|