Cp4.1LG15g05030 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCACTCCCGTCGACCAGCTCCAGCCCCCGCCGACCGCTCATTCCGGCCACGGCTCCGTCGGCCCAGTCATCGCCGTCCTCGCAGTCATTTCCATCCTCGGCGTCATCGCCGGCATTATCGGCCGTCTCTGCTCCGGCCGCCCCGTCTTCGGCTACGGCGCCCACTACGACGTCGAGGACTGGGTCGAGAAGAAATGTGCTTCCTGCCTCGACGGCTCCCTCGACCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCTCCGCCACCCTCCGCCGCTGGATGCCGTTCCTGTAGTCGAACCCCTTGGTGGGCCGCCGGAAATCAAGCAAGGCGCCGATGACAAACGCGAGAATTTGCAGTCGGCGGCTCCCGGAACCGGCGGCGGTGAGTCGTGA ATGTCCACTCCCGTCGACCAGCTCCAGCCCCCGCCGACCGCTCATTCCGGCCACGGCTCCGTCGGCCCAGTCATCGCCGTCCTCGCAGTCATTTCCATCCTCGGCGTCATCGCCGGCATTATCGGCCGTCTCTGCTCCGGCCGCCCCGTCTTCGGCTACGGCGCCCACTACGACGTCGAGGACTGGGTCGAGAAGAAATGTGCTTCCTGCCTCGACGGCTCCCTCGACCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCTCCGCCACCCTCCGCCGCTGGATGCCGTTCCTGTAGTCGAACCCCTTGGTGGGCCGCCGGAAATCAAGCAAGGCGCCGATGACAAACGCGAGAATTTGCAGTCGGCGGCTCCCGGAACCGGCGGCGGTGAGTCGTGA ATGTCCACTCCCGTCGACCAGCTCCAGCCCCCGCCGACCGCTCATTCCGGCCACGGCTCCGTCGGCCCAGTCATCGCCGTCCTCGCAGTCATTTCCATCCTCGGCGTCATCGCCGGCATTATCGGCCGTCTCTGCTCCGGCCGCCCCGTCTTCGGCTACGGCGCCCACTACGACGTCGAGGACTGGGTCGAGAAGAAATGTGCTTCCTGCCTCGACGGCTCCCTCGACCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCTCCGCCACCCTCCGCCGCTGGATGCCGTTCCTGTAGTCGAACCCCTTGGTGGGCCGCCGGAAATCAAGCAAGGCGCCGATGACAAACGCGAGAATTTGCAGTCGGCGGCTCCCGGAACCGGCGGCGGTGAGTCGTGA MSTPVDQLQPPPTAHSGHGSVGPVIAVLAVISILGVIAGIIGRLCSGRPVFGYGAHYDVEDWVEKKCASCLDGSLDPPPPPPPPPHLRHPPPLDAVPVVEPLGGPPEIKQGADDKRENLQSAAPGTGGGES
BLAST of Cp4.1LG15g05030 vs. TrEMBL
Match: A0A0A0K6N4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G074850 PE=4 SV=1) HSP 1 Score: 216.1 bits (549), Expect = 2.6e-53 Identity = 112/133 (84.21%), Postives = 117/133 (87.97%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TrEMBL
Match: A0A067KPY1_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04879 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.2e-26 Identity = 72/133 (54.14%), Postives = 90/133 (67.67%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TrEMBL
Match: A0A061E7I4_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_007002 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.5e-26 Identity = 63/90 (70.00%), Postives = 74/90 (82.22%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TrEMBL
Match: A5BS04_VITVI (Peroxidase OS=Vitis vinifera GN=VITISV_035943 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 3.0e-25 Identity = 74/125 (59.20%), Postives = 85/125 (68.00%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TrEMBL
Match: I1JEX1_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_02G134900 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.6e-23 Identity = 76/136 (55.88%), Postives = 88/136 (64.71%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TAIR10
Match: AT3G57500.1 (AT3G57500.1 unknown protein) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-14 Identity = 40/82 (48.78%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. TAIR10
Match: AT2G26520.1 (AT2G26520.1 unknown protein) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-13 Identity = 41/94 (43.62%), Postives = 56/94 (59.57%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. NCBI nr
Match: gi|659110987|ref|XP_008455516.1| (PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 [Cucumis melo]) HSP 1 Score: 226.5 bits (576), Expect = 2.7e-56 Identity = 117/132 (88.64%), Postives = 121/132 (91.67%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. NCBI nr
Match: gi|700188719|gb|KGN43952.1| (hypothetical protein Csa_7G074850 [Cucumis sativus]) HSP 1 Score: 216.1 bits (549), Expect = 3.7e-53 Identity = 112/133 (84.21%), Postives = 117/133 (87.97%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. NCBI nr
Match: gi|1009115432|ref|XP_015874226.1| (PREDICTED: transcription factor RBF1-like [Ziziphus jujuba]) HSP 1 Score: 128.3 bits (321), Expect = 1.0e-26 Identity = 73/127 (57.48%), Postives = 89/127 (70.08%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. NCBI nr
Match: gi|802598804|ref|XP_012072449.1| (PREDICTED: uncharacterized protein LOC105634230 [Jatropha curcas]) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 72/133 (54.14%), Postives = 90/133 (67.67%), Query Frame = 1
BLAST of Cp4.1LG15g05030 vs. NCBI nr
Match: gi|590686362|ref|XP_007042357.1| (Uncharacterized protein TCM_007002 [Theobroma cacao]) HSP 1 Score: 125.9 bits (315), Expect = 5.0e-26 Identity = 63/90 (70.00%), Postives = 74/90 (82.22%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|