CmaCh08G012090 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGACCGTAAACAAGTTGGTGTTAGACAGGCCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTGTCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTCCCGGGGGGGAAAGAAATCGAGCAAGCTCTCATTCGGATCGGTTGCAGTCCTGCCGTGCCTGCAGTGTTCATCGGCGACCAACTGATCGGTGGTGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGAGCTTTGTGGGTTTAA ATGGAGACCGTAAACAAGTTGGTGTTAGACAGGCCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTGTCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTCCCGGGGGGGAAAGAAATCGAGCAAGCTCTCATTCGGATCGGTTGCAGTCCTGCCGTGCCTGCAGTGTTCATCGGCGACCAACTGATCGGTGGTGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGAGCTTTGTGGGTTTAA ATGGAGACCGTAAACAAGTTGGTGTTAGACAGGCCTGTCGTGGTGTTCAGCAAGAACAGTTGCTGTATGAGCCACACTGTCAAGTCACTCTTGTGCGACTTTGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTCCCGGGGGGGAAAGAAATCGAGCAAGCTCTCATTCGGATCGGTTGCAGTCCTGCCGTGCCTGCAGTGTTCATCGGCGACCAACTGATCGGTGGTGCGAATGAAGTGATGAGCCTTCATCTTAAGCGGAACTTGATCCCCATGCTTAGAAGGGCTGGAGCTTTGTGGGTTTAA METVNKLVLDRPVVVFSKNSCCMSHTVKSLLCDFGVNPTVYELDELPGGKEIEQALIRIGCSPAVPAVFIGDQLIGGANEVMSLHLKRNLIPMLRRAGALWV
BLAST of CmaCh08G012090 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 8.7e-42 Identity = 74/102 (72.55%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of CmaCh08G012090 vs. Swiss-Prot
Match: GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.0e-39 Identity = 70/102 (68.63%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of CmaCh08G012090 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.0e-39 Identity = 69/102 (67.65%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of CmaCh08G012090 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.5e-38 Identity = 69/102 (67.65%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of CmaCh08G012090 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 157.5 bits (397), Expect = 7.6e-38 Identity = 69/102 (67.65%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TrEMBL
Match: U3RJA0_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX3 PE=2 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 2.8e-47 Identity = 91/102 (89.22%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TrEMBL
Match: D7LYE9_ARALL (Glutaredoxin family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_488744 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.5e-40 Identity = 75/102 (73.53%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TrEMBL
Match: A0A078EKR9_BRANA (BnaC02g08250D protein OS=Brassica napus GN=BnaC02g08250D PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.5e-40 Identity = 76/102 (74.51%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TrEMBL
Match: M4E4I5_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 1.9e-40 Identity = 76/102 (74.51%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TrEMBL
Match: V4LHG7_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10015538mg PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 2.5e-40 Identity = 76/102 (74.51%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 170.6 bits (431), Expect = 4.9e-43 Identity = 74/102 (72.55%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TAIR10
Match: AT4G15690.1 (AT4G15690.1 Thioredoxin superfamily protein) HSP 1 Score: 161.8 bits (408), Expect = 2.3e-40 Identity = 70/102 (68.63%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 160.6 bits (405), Expect = 5.1e-40 Identity = 69/102 (67.65%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 159.8 bits (403), Expect = 8.6e-40 Identity = 69/102 (67.65%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of CmaCh08G012090 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 157.5 bits (397), Expect = 4.3e-39 Identity = 69/102 (67.65%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of CmaCh08G012090 vs. NCBI nr
Match: gi|566006172|ref|NP_001274383.1| (monothiol glutaredoxin-S2-like [Cucumis sativus]) HSP 1 Score: 195.7 bits (496), Expect = 4.0e-47 Identity = 91/102 (89.22%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of CmaCh08G012090 vs. NCBI nr
Match: gi|727563611|ref|XP_010454112.1| (PREDICTED: monothiol glutaredoxin-S2-like [Camelina sativa]) HSP 1 Score: 174.1 bits (440), Expect = 1.3e-40 Identity = 77/102 (75.49%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of CmaCh08G012090 vs. NCBI nr
Match: gi|951003839|ref|XP_014507713.1| (PREDICTED: monothiol glutaredoxin-S2-like [Vigna radiata var. radiata]) HSP 1 Score: 173.7 bits (439), Expect = 1.6e-40 Identity = 77/102 (75.49%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of CmaCh08G012090 vs. NCBI nr
Match: gi|727489185|ref|XP_010420636.1| (PREDICTED: monothiol glutaredoxin-S2 [Camelina sativa]) HSP 1 Score: 173.7 bits (439), Expect = 1.6e-40 Identity = 76/102 (74.51%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of CmaCh08G012090 vs. NCBI nr
Match: gi|297812045|ref|XP_002873906.1| (glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 173.3 bits (438), Expect = 2.1e-40 Identity = 75/102 (73.53%), Postives = 94/102 (92.16%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|