CsGy6G014770 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGACTGTCAACAAGTTGGTTTCTGATAGGCCGGTGGTAGTTTTCAGCAAGAATAGTTGCTGTATGAGCCACTCTATCAAGACACTCTTGTGTGATTTCGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTTCCCAGAGGGAAAGAGATAGAGCAAGCTCTTCTTCGGATTGGCTGTAATCCTGCCGTACCTGCCGTGTTCATTGGTGGGGAACTGGTCGGTGGTGCTAACGAAGTCATGAGTCTTCATCTTAAGCGAAACCTGATCCCAATGCTTAGGAAGGCCGGTGCTCTATGGGTTTAA ATGGAGACTGTCAACAAGTTGGTTTCTGATAGGCCGGTGGTAGTTTTCAGCAAGAATAGTTGCTGTATGAGCCACTCTATCAAGACACTCTTGTGTGATTTCGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTTCCCAGAGGGAAAGAGATAGAGCAAGCTCTTCTTCGGATTGGCTGTAATCCTGCCGTACCTGCCGTGTTCATTGGTGGGGAACTGGTCGGTGGTGCTAACGAAGTCATGAGTCTTCATCTTAAGCGAAACCTGATCCCAATGCTTAGGAAGGCCGGTGCTCTATGGGTTTAA ATGGAGACTGTCAACAAGTTGGTTTCTGATAGGCCGGTGGTAGTTTTCAGCAAGAATAGTTGCTGTATGAGCCACTCTATCAAGACACTCTTGTGTGATTTCGGAGTTAACCCGACGGTGTACGAGCTCGATGAGCTTCCCAGAGGGAAAGAGATAGAGCAAGCTCTTCTTCGGATTGGCTGTAATCCTGCCGTACCTGCCGTGTTCATTGGTGGGGAACTGGTCGGTGGTGCTAACGAAGTCATGAGTCTTCATCTTAAGCGAAACCTGATCCCAATGCTTAGGAAGGCCGGTGCTCTATGGGTTTAA METVNKLVSDRPVVVFSKNSCCMSHSIKTLLCDFGVNPTVYELDELPRGKEIEQALLRIGCNPAVPAVFIGGELVGGANEVMSLHLKRNLIPMLRKAGALWV
BLAST of CsGy6G014770 vs. NCBI nr
Match: NP_001274383.1 (monothiol glutaredoxin-S2-like [Cucumis sativus] >XP_008458479.1 PREDICTED: monothiol glutaredoxin-S2-like [Cucumis melo] >AGX01495.1 glutaredoxin [Cucumis sativus] >KGN47200.1 Glutaredoxin family protein [Cucumis sativus]) HSP 1 Score: 211.8 bits (538), Expect = 1.1e-51 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of CsGy6G014770 vs. NCBI nr
Match: XP_022959348.1 (monothiol glutaredoxin-S2-like [Cucurbita moschata]) HSP 1 Score: 209.1 bits (531), Expect = 6.8e-51 Identity = 99/102 (97.06%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of CsGy6G014770 vs. NCBI nr
Match: XP_023006259.1 (monothiol glutaredoxin-S2-like [Cucurbita maxima]) HSP 1 Score: 206.5 bits (524), Expect = 4.4e-50 Identity = 99/102 (97.06%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of CsGy6G014770 vs. NCBI nr
Match: XP_023548757.1 (monothiol glutaredoxin-S2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 204.9 bits (520), Expect = 1.3e-49 Identity = 97/102 (95.10%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of CsGy6G014770 vs. NCBI nr
Match: XP_022138745.1 (monothiol glutaredoxin-S2-like [Momordica charantia]) HSP 1 Score: 201.1 bits (510), Expect = 1.9e-48 Identity = 96/99 (96.97%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of CsGy6G014770 vs. TAIR10
Match: AT5G18600.1 (Thioredoxin superfamily protein) HSP 1 Score: 175.3 bits (443), Expect = 2.0e-44 Identity = 78/102 (76.47%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of CsGy6G014770 vs. TAIR10
Match: AT4G15680.1 (Thioredoxin superfamily protein) HSP 1 Score: 165.6 bits (418), Expect = 1.6e-41 Identity = 71/102 (69.61%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of CsGy6G014770 vs. TAIR10
Match: AT4G15700.1 (Thioredoxin superfamily protein) HSP 1 Score: 164.9 bits (416), Expect = 2.7e-41 Identity = 71/102 (69.61%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of CsGy6G014770 vs. TAIR10
Match: AT4G15690.1 (Thioredoxin superfamily protein) HSP 1 Score: 164.5 bits (415), Expect = 3.5e-41 Identity = 71/102 (69.61%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of CsGy6G014770 vs. TAIR10
Match: AT4G15670.1 (Thioredoxin superfamily protein) HSP 1 Score: 162.5 bits (410), Expect = 1.3e-40 Identity = 71/102 (69.61%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of CsGy6G014770 vs. Swiss-Prot
Match: sp|Q8L8Z8|GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana OX=3702 GN=GRXS2 PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.6e-43 Identity = 78/102 (76.47%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of CsGy6G014770 vs. Swiss-Prot
Match: sp|O23419|GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana OX=3702 GN=GRXS4 PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 2.8e-40 Identity = 71/102 (69.61%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of CsGy6G014770 vs. Swiss-Prot
Match: sp|O23421|GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana OX=3702 GN=GRXS3 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.8e-40 Identity = 71/102 (69.61%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of CsGy6G014770 vs. Swiss-Prot
Match: sp|O23420|GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana OX=3702 GN=GRXS5 PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 6.3e-40 Identity = 71/102 (69.61%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of CsGy6G014770 vs. Swiss-Prot
Match: sp|Q6NLU2|GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana OX=3702 GN=GRXS7 PE=3 SV=2) HSP 1 Score: 162.5 bits (410), Expect = 2.4e-39 Identity = 71/102 (69.61%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of CsGy6G014770 vs. TrEMBL
Match: tr|U3RJA0|U3RJA0_CUCSA (Glutaredoxin family protein OS=Cucumis sativus OX=3659 GN=GRX3 PE=2 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 7.0e-52 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of CsGy6G014770 vs. TrEMBL
Match: tr|A0A1S3C966|A0A1S3C966_CUCME (monothiol glutaredoxin-S2-like OS=Cucumis melo OX=3656 GN=LOC103497874 PE=4 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 7.0e-52 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of CsGy6G014770 vs. TrEMBL
Match: tr|A0A2P6QY55|A0A2P6QY55_ROSCH (Putative oxidoreductase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0421391 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 6.3e-45 Identity = 86/102 (84.31%), Postives = 96/102 (94.12%), Query Frame = 0
BLAST of CsGy6G014770 vs. TrEMBL
Match: tr|A0A1S3UNR4|A0A1S3UNR4_VIGRR (monothiol glutaredoxin-S2-like OS=Vigna radiata var. radiata OX=3916 GN=LOC106767354 PE=4 SV=1) HSP 1 Score: 183.3 bits (464), Expect = 2.7e-43 Identity = 83/102 (81.37%), Postives = 97/102 (95.10%), Query Frame = 0
BLAST of CsGy6G014770 vs. TrEMBL
Match: tr|A0A2P6QY32|A0A2P6QY32_ROSCH (Putative thioredoxin-disulfide reductase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0421401 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 5.9e-43 Identity = 81/102 (79.41%), Postives = 95/102 (93.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|