Cp4.1LG08g04750 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAGAGTTAGAAGGATGGTTTCAGAGCGGCCGGTCGTGATCTTCAGCAAGAGCACGTGCTGCATGAGCCACACTGTGATGAGGCTGCTGAGTGGGTTTGGGGTTAACCCGGCGGTGCACGAGGTGGACCAGATCGCTCGAGGCAGGGAGATCGAGCAGGCTCTGTCTATGCTTGGCTTTAGCCCCACGGTTCCGGCTGTCTTCATTGGCGGCCAACTGGTCGGTGGAACCAATGAAATTATGACACTTCATCTTAATCGCTCCCTCATTCCCATGCTTACTGCTGCTGGCGCTTTGTGGGTTTGA ATGGAGAGAGTTAGAAGGATGGTTTCAGAGCGGCCGGTCGTGATCTTCAGCAAGAGCACGTGCTGCATGAGCCACACTGTGATGAGGCTGCTGAGTGGGTTTGGGGTTAACCCGGCGGTGCACGAGGTGGACCAGATCGCTCGAGGCAGGGAGATCGAGCAGGCTCTGTCTATGCTTGGCTTTAGCCCCACGGTTCCGGCTGTCTTCATTGGCGGCCAACTGGTCGGTGGAACCAATGAAATTATGACACTTCATCTTAATCGCTCCCTCATTCCCATGCTTACTGCTGCTGGCGCTTTGTGGGTTTGA ATGGAGAGAGTTAGAAGGATGGTTTCAGAGCGGCCGGTCGTGATCTTCAGCAAGAGCACGTGCTGCATGAGCCACACTGTGATGAGGCTGCTGAGTGGGTTTGGGGTTAACCCGGCGGTGCACGAGGTGGACCAGATCGCTCGAGGCAGGGAGATCGAGCAGGCTCTGTCTATGCTTGGCTTTAGCCCCACGGTTCCGGCTGTCTTCATTGGCGGCCAACTGGTCGGTGGAACCAATGAAATTATGACACTTCATCTTAATCGCTCCCTCATTCCCATGCTTACTGCTGCTGGCGCTTTGTGGGTTTGA MERVRRMVSERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHEVDQIARGREIEQALSMLGFSPTVPAVFIGGQLVGGTNEIMTLHLNRSLIPMLTAAGALWV
BLAST of Cp4.1LG08g04750 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.4e-36 Identity = 72/102 (70.59%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. Swiss-Prot
Match: GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-35 Identity = 68/102 (66.67%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-35 Identity = 66/102 (64.71%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 4.6e-35 Identity = 66/102 (64.71%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 146.4 bits (368), Expect = 1.8e-34 Identity = 66/102 (64.71%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TrEMBL
Match: A0A0A0L8Y9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G152090 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.5e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TrEMBL
Match: A0A0B2P756_GLYSO (Monothiol glutaredoxin-S2 OS=Glycine soja GN=glysoja_004410 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 2.4e-38 Identity = 80/102 (78.43%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TrEMBL
Match: I1MRF6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_17G023900 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 2.4e-38 Identity = 80/102 (78.43%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TrEMBL
Match: A0A0B2P118_GLYSO (Monothiol glutaredoxin-S2 OS=Glycine soja GN=glysoja_009861 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.5e-37 Identity = 78/102 (76.47%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TrEMBL
Match: I1KN22_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_07G250500 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.5e-37 Identity = 78/102 (76.47%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 152.5 bits (384), Expect = 1.4e-37 Identity = 72/102 (70.59%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TAIR10
Match: AT4G15690.1 (AT4G15690.1 Thioredoxin superfamily protein) HSP 1 Score: 149.4 bits (376), Expect = 1.2e-36 Identity = 68/102 (66.67%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 149.4 bits (376), Expect = 1.2e-36 Identity = 66/102 (64.71%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 148.3 bits (373), Expect = 2.6e-36 Identity = 66/102 (64.71%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 146.4 bits (368), Expect = 9.9e-36 Identity = 66/102 (64.71%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. NCBI nr
Match: gi|449432817|ref|XP_004134195.1| (PREDICTED: monothiol glutaredoxin-S2 [Cucumis sativus]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. NCBI nr
Match: gi|356563857|ref|XP_003550174.1| (PREDICTED: monothiol glutaredoxin-S2 [Glycine max]) HSP 1 Score: 166.0 bits (419), Expect = 3.4e-38 Identity = 80/102 (78.43%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. NCBI nr
Match: gi|502151147|ref|XP_004508301.1| (PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]) HSP 1 Score: 164.1 bits (414), Expect = 1.3e-37 Identity = 77/102 (75.49%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. NCBI nr
Match: gi|1012003897|ref|XP_015938975.1| (PREDICTED: monothiol glutaredoxin-S2-like [Arachis duranensis]) HSP 1 Score: 163.7 bits (413), Expect = 1.7e-37 Identity = 77/102 (75.49%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of Cp4.1LG08g04750 vs. NCBI nr
Match: gi|951003839|ref|XP_014507713.1| (PREDICTED: monothiol glutaredoxin-S2-like [Vigna radiata var. radiata]) HSP 1 Score: 163.3 bits (412), Expect = 2.2e-37 Identity = 78/102 (76.47%), Postives = 89/102 (87.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |