MELO3C006621 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATCGGTTCTAGTTTGCCTTCTACATTACATACGTTGATTTGGTTCAAAAAAAAAAAATATTTAACTTTGGTTTAAATTGCTATACGTTCCCTTACAAATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGAACTTCACCCTAGCTATATCGAATAAATTAACCGTCGTGATCATAGTTCATATGCTTAGATAAGAGCTAGTAC ATCGGTTCTAGTTTGCCTTCTACATTACATACGTTGATTTGGTTCAAAAAAAAAAAATATTTAACTTTGGTTTAAATTGCTATACGTTCCCTTACAAATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGAACTTCACCCTAGCTATATCGAATAAATTAACCGTCGTGATCATAGTTCATATGCTTAGATAAGAGCTAGTAC ATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGA MDRVTRLISERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHELDQISRGREVEQALSRLGFNPTVPAVFIGGELVGGANEVMSLHLNRSLIPMLRKAGALWV*
BLAST of MELO3C006621 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 1.1e-39 Identity = 77/102 (75.49%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of MELO3C006621 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 8.5e-37 Identity = 68/102 (66.67%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of MELO3C006621 vs. Swiss-Prot
Match: GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana GN=GRXS5 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 5.5e-36 Identity = 68/102 (66.67%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of MELO3C006621 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-35 Identity = 67/102 (65.69%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of MELO3C006621 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 147.5 bits (371), Expect = 8.0e-35 Identity = 65/102 (63.73%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of MELO3C006621 vs. TrEMBL
Match: A0A0A0L8Y9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G152090 PE=4 SV=1) HSP 1 Score: 204.1 bits (518), Expect = 8.0e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C006621 vs. TrEMBL
Match: A0A0B2P756_GLYSO (Monothiol glutaredoxin-S2 OS=Glycine soja GN=glysoja_004410 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 6.8e-41 Identity = 83/102 (81.37%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of MELO3C006621 vs. TrEMBL
Match: I1MRF6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_17G023900 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 6.8e-41 Identity = 83/102 (81.37%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of MELO3C006621 vs. TrEMBL
Match: A0A151STF3_CAJCA (Monothiol glutaredoxin-S2 OS=Cajanus cajan GN=KK1_004347 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.2e-40 Identity = 83/102 (81.37%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of MELO3C006621 vs. TrEMBL
Match: A0A0D2VNY3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G187400 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.5e-40 Identity = 83/102 (81.37%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of MELO3C006621 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 163.7 bits (413), Expect = 6.0e-41 Identity = 77/102 (75.49%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of MELO3C006621 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 154.1 bits (388), Expect = 4.8e-38 Identity = 68/102 (66.67%), Postives = 89/102 (87.25%), Query Frame = 1
BLAST of MELO3C006621 vs. TAIR10
Match: AT4G15690.1 (AT4G15690.1 Thioredoxin superfamily protein) HSP 1 Score: 151.4 bits (381), Expect = 3.1e-37 Identity = 68/102 (66.67%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of MELO3C006621 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 150.2 bits (378), Expect = 6.9e-37 Identity = 67/102 (65.69%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of MELO3C006621 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 147.5 bits (371), Expect = 4.5e-36 Identity = 65/102 (63.73%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of MELO3C006621 vs. NCBI nr
Match: gi|449432817|ref|XP_004134195.1| (PREDICTED: monothiol glutaredoxin-S2 [Cucumis sativus]) HSP 1 Score: 204.1 bits (518), Expect = 1.1e-49 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C006621 vs. NCBI nr
Match: gi|1012003897|ref|XP_015938975.1| (PREDICTED: monothiol glutaredoxin-S2-like [Arachis duranensis]) HSP 1 Score: 176.8 bits (447), Expect = 2.0e-41 Identity = 84/102 (82.35%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of MELO3C006621 vs. NCBI nr
Match: gi|356563857|ref|XP_003550174.1| (PREDICTED: monothiol glutaredoxin-S2 [Glycine max]) HSP 1 Score: 174.5 bits (441), Expect = 9.7e-41 Identity = 83/102 (81.37%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of MELO3C006621 vs. NCBI nr
Match: gi|1012346864|gb|KYP58056.1| (Monothiol glutaredoxin-S2 [Cajanus cajan]) HSP 1 Score: 173.7 bits (439), Expect = 1.7e-40 Identity = 83/102 (81.37%), Postives = 94/102 (92.16%), Query Frame = 1
BLAST of MELO3C006621 vs. NCBI nr
Match: gi|823240821|ref|XP_012453018.1| (PREDICTED: monothiol glutaredoxin-S2-like [Gossypium raimondii]) HSP 1 Score: 173.3 bits (438), Expect = 2.2e-40 Identity = 83/102 (81.37%), Postives = 92/102 (90.20%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |