CmaCh14G016360 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCGGATAGCGAAGGTTGCGTCACAGAAGGCGGTGGTGATATTCAGCAAGAGCTCGTGTTGCATGAGCCATGCAATTAAGAGACTCTTTTACGATCAAGGCATCAGCCCGGCTGTGTACGAGCTCGACCAGGACTCGAGAGGAAAAGAGATCGAATGGGCCCTTTGGTGCCTCGGCTGCAACCCCACCGTCCCTGCCGTCTTCATCGGTGGCCGATTCATCGGCACCGCCAATGCCATCATCACTCTTCACCTTAATGGTTGTCTCGACAAATTGTTAAAGGAAGCTGGTGCGCTTTGGCTCTGA ATGGAGCGGATAGCGAAGGTTGCGTCACAGAAGGCGGTGGTGATATTCAGCAAGAGCTCGTGTTGCATGAGCCATGCAATTAAGAGACTCTTTTACGATCAAGGCATCAGCCCGGCTGTGTACGAGCTCGACCAGGACTCGAGAGGAAAAGAGATCGAATGGGCCCTTTGGTGCCTCGGCTGCAACCCCACCGTCCCTGCCGTCTTCATCGGTGGCCGATTCATCGGCACCGCCAATGCCATCATCACTCTTCACCTTAATGGTTGTCTCGACAAATTGTTAAAGGAAGCTGGTGCGCTTTGGCTCTGA ATGGAGCGGATAGCGAAGGTTGCGTCACAGAAGGCGGTGGTGATATTCAGCAAGAGCTCGTGTTGCATGAGCCATGCAATTAAGAGACTCTTTTACGATCAAGGCATCAGCCCGGCTGTGTACGAGCTCGACCAGGACTCGAGAGGAAAAGAGATCGAATGGGCCCTTTGGTGCCTCGGCTGCAACCCCACCGTCCCTGCCGTCTTCATCGGTGGCCGATTCATCGGCACCGCCAATGCCATCATCACTCTTCACCTTAATGGTTGTCTCGACAAATTGTTAAAGGAAGCTGGTGCGCTTTGGCTCTGA MERIAKVASQKAVVIFSKSSCCMSHAIKRLFYDQGISPAVYELDQDSRGKEIEWALWCLGCNPTVPAVFIGGRFIGTANAIITLHLNGCLDKLLKEAGALWL
BLAST of CmaCh14G016360 vs. Swiss-Prot
Match: GRS10_ARATH (Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 2.1e-40 Identity = 75/102 (73.53%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of CmaCh14G016360 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 2.8e-32 Identity = 65/102 (63.73%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. Swiss-Prot
Match: GRXS8_ARATH (Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana GN=GRXS8 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.4e-31 Identity = 63/102 (61.76%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 136.3 bits (342), Expect = 1.8e-31 Identity = 62/102 (60.78%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 3.1e-31 Identity = 62/102 (60.78%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TrEMBL
Match: U3RBS4_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX5 PE=2 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 1.3e-47 Identity = 94/102 (92.16%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TrEMBL
Match: B9MZY7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s22890g PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 2.1e-42 Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TrEMBL
Match: B9RT13_RICCO (Glutaredoxin, grx, putative OS=Ricinus communis GN=RCOM_0680270 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 2.7e-42 Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TrEMBL
Match: M5Y0I0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa025150mg PE=4 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.6e-42 Identity = 81/102 (79.41%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TrEMBL
Match: D7T6I0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g01760 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.1e-42 Identity = 79/102 (77.45%), Postives = 96/102 (94.12%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TAIR10
Match: AT3G21460.1 (AT3G21460.1 Glutaredoxin family protein) HSP 1 Score: 166.0 bits (419), Expect = 1.2e-41 Identity = 75/102 (73.53%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 139.0 bits (349), Expect = 1.6e-33 Identity = 65/102 (63.73%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TAIR10
Match: AT4G15660.1 (AT4G15660.1 Thioredoxin superfamily protein) HSP 1 Score: 136.7 bits (343), Expect = 7.8e-33 Identity = 63/102 (61.76%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 136.3 bits (342), Expect = 1.0e-32 Identity = 62/102 (60.78%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 135.6 bits (340), Expect = 1.7e-32 Identity = 62/102 (60.78%), Postives = 81/102 (79.41%), Query Frame = 1
BLAST of CmaCh14G016360 vs. NCBI nr
Match: gi|568384775|ref|NP_001275534.1| (monothiol glutaredoxin-S10-like [Cucumis sativus]) HSP 1 Score: 196.8 bits (499), Expect = 1.8e-47 Identity = 94/102 (92.16%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of CmaCh14G016360 vs. NCBI nr
Match: gi|566185448|ref|XP_006380203.1| (hypothetical protein POPTR_0008s22890g [Populus trichocarpa]) HSP 1 Score: 179.5 bits (454), Expect = 3.0e-42 Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of CmaCh14G016360 vs. NCBI nr
Match: gi|743943078|ref|XP_011016037.1| (PREDICTED: monothiol glutaredoxin-S10 [Populus euphratica]) HSP 1 Score: 179.5 bits (454), Expect = 3.0e-42 Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of CmaCh14G016360 vs. NCBI nr
Match: gi|1000971383|ref|XP_015573300.1| (PREDICTED: monothiol glutaredoxin-S10 [Ricinus communis]) HSP 1 Score: 179.1 bits (453), Expect = 3.9e-42 Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 1
BLAST of CmaCh14G016360 vs. NCBI nr
Match: gi|596292637|ref|XP_007226534.1| (hypothetical protein PRUPE_ppa025150mg [Prunus persica]) HSP 1 Score: 178.7 bits (452), Expect = 5.1e-42 Identity = 81/102 (79.41%), Postives = 97/102 (95.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|