MELO3C006620 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACGCATAGCGAAGGTTGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCCTGCTGCATGAGCCATGCAATTAAGAGACTATTTTACGACCAAGGCGTGAGCCCGGCCGTGTACGAGCTCGACGAGGACTCCAGAGGAAAAGAAATCGAATGGGCCCTTTTACGCCTCGGCTGCAACCCCGCCGTCCCTGCCGTCTTCATCGGCGGCCGCTTCGTCGGCTCCGCCAATGCTATCATCACCCTCCACCTCAATGGCTGCCTCAACAAATTGCTCAAAGAAGCCGGAGCTCTTTGGCTTTAA ATGGAACGCATAGCGAAGGTTGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCCTGCTGCATGAGCCATGCAATTAAGAGACTATTTTACGACCAAGGCGTGAGCCCGGCCGTGTACGAGCTCGACGAGGACTCCAGAGGAAAAGAAATCGAATGGGCCCTTTTACGCCTCGGCTGCAACCCCGCCGTCCCTGCCGTCTTCATCGGCGGCCGCTTCGTCGGCTCCGCCAATGCTATCATCACCCTCCACCTCAATGGCTGCCTCAACAAATTGCTCAAAGAAGCCGGAGCTCTTTGGCTTTAA ATGGAACGCATAGCGAAGGTTGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCCTGCTGCATGAGCCATGCAATTAAGAGACTATTTTACGACCAAGGCGTGAGCCCGGCCGTGTACGAGCTCGACGAGGACTCCAGAGGAAAAGAAATCGAATGGGCCCTTTTACGCCTCGGCTGCAACCCCGCCGTCCCTGCCGTCTTCATCGGCGGCCGCTTCGTCGGCTCCGCCAATGCTATCATCACCCTCCACCTCAATGGCTGCCTCAACAAATTGCTCAAAGAAGCCGGAGCTCTTTGGCTTTAA MERIAKVASQKAVVIFSKSSCCMSHAIKRLFYDQGVSPAVYELDEDSRGKEIEWALLRLGCNPAVPAVFIGGRFVGSANAIITLHLNGCLNKLLKEAGALWL*
BLAST of MELO3C006620 vs. Swiss-Prot
Match: GRS10_ARATH (Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.8e-40 Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of MELO3C006620 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 9.7e-33 Identity = 67/102 (65.69%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. Swiss-Prot
Match: GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana GN=GRXS2 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.2e-32 Identity = 67/102 (65.69%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of MELO3C006620 vs. Swiss-Prot
Match: GRXS8_ARATH (Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana GN=GRXS8 PE=3 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.8e-32 Identity = 65/102 (63.73%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. Swiss-Prot
Match: GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana GN=GRXS7 PE=3 SV=2) HSP 1 Score: 137.9 bits (346), Expect = 6.3e-32 Identity = 64/102 (62.75%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. TrEMBL
Match: U3RBS4_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX5 PE=2 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 9.4e-51 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C006620 vs. TrEMBL
Match: B9MZY7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s22890g PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 2.9e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C006620 vs. TrEMBL
Match: W9R6U2_9ROSA (Monothiol glutaredoxin-S10 OS=Morus notabilis GN=L484_023577 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.8e-44 Identity = 88/102 (86.27%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C006620 vs. TrEMBL
Match: B9RT13_RICCO (Glutaredoxin, grx, putative OS=Ricinus communis GN=RCOM_0680270 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.8e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C006620 vs. TrEMBL
Match: M5Y0I0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa025150mg PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.8e-44 Identity = 86/102 (84.31%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of MELO3C006620 vs. TAIR10
Match: AT3G21460.1 (AT3G21460.1 Glutaredoxin family protein) HSP 1 Score: 164.9 bits (416), Expect = 2.7e-41 Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of MELO3C006620 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 140.6 bits (353), Expect = 5.5e-34 Identity = 67/102 (65.69%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 139.4 bits (350), Expect = 1.2e-33 Identity = 67/102 (65.69%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of MELO3C006620 vs. TAIR10
Match: AT4G15660.1 (AT4G15660.1 Thioredoxin superfamily protein) HSP 1 Score: 138.3 bits (347), Expect = 2.7e-33 Identity = 65/102 (63.73%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 137.9 bits (346), Expect = 3.5e-33 Identity = 64/102 (62.75%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006620 vs. NCBI nr
Match: gi|568384775|ref|NP_001275534.1| (monothiol glutaredoxin-S10-like [Cucumis sativus]) HSP 1 Score: 207.2 bits (526), Expect = 1.4e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C006620 vs. NCBI nr
Match: gi|566185448|ref|XP_006380203.1| (hypothetical protein POPTR_0008s22890g [Populus trichocarpa]) HSP 1 Score: 185.7 bits (470), Expect = 4.2e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C006620 vs. NCBI nr
Match: gi|703105776|ref|XP_010098329.1| (Monothiol glutaredoxin-S10 [Morus notabilis]) HSP 1 Score: 185.3 bits (469), Expect = 5.5e-44 Identity = 88/102 (86.27%), Postives = 97/102 (95.10%), Query Frame = 1
BLAST of MELO3C006620 vs. NCBI nr
Match: gi|596292637|ref|XP_007226534.1| (hypothetical protein PRUPE_ppa025150mg [Prunus persica]) HSP 1 Score: 185.3 bits (469), Expect = 5.5e-44 Identity = 86/102 (84.31%), Postives = 99/102 (97.06%), Query Frame = 1
BLAST of MELO3C006620 vs. NCBI nr
Match: gi|1000971383|ref|XP_015573300.1| (PREDICTED: monothiol glutaredoxin-S10 [Ricinus communis]) HSP 1 Score: 185.3 bits (469), Expect = 5.5e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|