CmaCh00G003360 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GATCTCTCTCTTTCTCTCTCTTCTTCATCATTTCTTCCACAGATTTGTTTCTTTGGAGAGGGACAGCAACAATGGCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATTGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTCCCGCTAGCGACGGTAATCTACGCATCTGATTTCTAAACTCCATCAGCTTTTGTGTCTGCTTTGTCCTTTTTGTTGATTGATGATGATGATGATGATGAATGTAGGTCTTTTCAAATTTTTTATTTGGAAGTGATTTGTTGACAATTTTGTGTAAAATCAGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGA GATCTCTCTCTTTCTCTCTCTTCTTCATCATTTCTTCCACAGATTTGTTTCTTTGGAGAGGGACAGCAACAATGGCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATTGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTCCCGCTAGCGACGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGA ATGGCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATTGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTCCCGCTAGCGACGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGA MASSSDSTPTAFSGFFTCFALIFFILLPLVHAHSSASAPAPAPASDGTSIDQGIAYVLMLMALVLTYLIHPLDASSYQFFLN
BLAST of CmaCh00G003360 vs. Swiss-Prot
Match: AGP16_ARATH (Arabinogalactan peptide 16 OS=Arabidopsis thaliana GN=AGP16 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 9.5e-15 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of CmaCh00G003360 vs. Swiss-Prot
Match: AGP20_ARATH (Arabinogalactan peptide 20 OS=Arabidopsis thaliana GN=AGP20 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 8.0e-14 Identity = 43/64 (67.19%), Postives = 50/64 (78.12%), Query Frame = 1
BLAST of CmaCh00G003360 vs. Swiss-Prot
Match: AGP22_ARATH (Arabinogalactan peptide 22 OS=Arabidopsis thaliana GN=AGP22 PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.9e-11 Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TrEMBL
Match: A0A0A0L7A0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G120410 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.1e-21 Identity = 60/79 (75.95%), Postives = 64/79 (81.01%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TrEMBL
Match: A0A061DUP4_THECC (Arabinogalactan protein 20 OS=Theobroma cacao GN=TCM_005200 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.2e-16 Identity = 51/70 (72.86%), Postives = 56/70 (80.00%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TrEMBL
Match: A0A0D2TCU0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G105900 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 49/64 (76.56%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TrEMBL
Match: A0A0B0PYH7_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_05303 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.3e-15 Identity = 49/69 (71.01%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TrEMBL
Match: A0A0B0PFR1_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_09698 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.0e-15 Identity = 49/63 (77.78%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TAIR10
Match: AT2G46330.1 (AT2G46330.1 arabinogalactan protein 16) HSP 1 Score: 80.5 bits (197), Expect = 5.4e-16 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TAIR10
Match: AT3G61640.1 (AT3G61640.1 arabinogalactan protein 20) HSP 1 Score: 77.4 bits (189), Expect = 4.5e-15 Identity = 43/64 (67.19%), Postives = 50/64 (78.12%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TAIR10
Match: AT5G24105.1 (AT5G24105.1 arabinogalactan protein 41) HSP 1 Score: 75.9 bits (185), Expect = 1.3e-14 Identity = 42/59 (71.19%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of CmaCh00G003360 vs. TAIR10
Match: AT5G53250.1 (AT5G53250.1 arabinogalactan protein 22) HSP 1 Score: 68.9 bits (167), Expect = 1.6e-12 Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of CmaCh00G003360 vs. NCBI nr
Match: gi|449432096|ref|XP_004133836.1| (PREDICTED: arabinogalactan peptide 20 [Cucumis sativus]) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-20 Identity = 60/79 (75.95%), Postives = 64/79 (81.01%), Query Frame = 1
BLAST of CmaCh00G003360 vs. NCBI nr
Match: gi|590721494|ref|XP_007051629.1| (Arabinogalactan protein 20 [Theobroma cacao]) HSP 1 Score: 93.6 bits (231), Expect = 1.7e-16 Identity = 51/70 (72.86%), Postives = 56/70 (80.00%), Query Frame = 1
BLAST of CmaCh00G003360 vs. NCBI nr
Match: gi|823187080|ref|XP_012490068.1| (PREDICTED: arabinogalactan peptide 20-like [Gossypium raimondii]) HSP 1 Score: 90.1 bits (222), Expect = 1.9e-15 Identity = 49/64 (76.56%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of CmaCh00G003360 vs. NCBI nr
Match: gi|728850111|gb|KHG29554.1| (hypothetical protein F383_05303 [Gossypium arboreum]) HSP 1 Score: 89.4 bits (220), Expect = 3.3e-15 Identity = 49/69 (71.01%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of CmaCh00G003360 vs. NCBI nr
Match: gi|720033434|ref|XP_010266430.1| (PREDICTED: arabinogalactan peptide 20-like [Nelumbo nucifera]) HSP 1 Score: 89.0 bits (219), Expect = 4.3e-15 Identity = 50/67 (74.63%), Postives = 52/67 (77.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|