Carg20869 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TCTCTGTGCTCTGTTTCTATAAAACCAAATCCCCACATTATCCTCCGATCTCTCTTTCTCTCTCTTCTTCATCATTTCTTCCACAGATCTGTTTCTTTGGAGAGGGACAGCAACAATGGCGTCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATCGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTAGCGACGGTAATCTACGCATCTGATTTCTAAGCTCCATCAGTTTTTGTGTCTGCATTGTCCTTTTTGTTGTTTGATGATGATGATGATGATGAATGTAGGTTTTTCAAATTTTTGATTTGGAAGTGATTTGTTGACAATTTTGTGTAAAATCAGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGAGTTCTAGGATTGTAGCAATGTTGGCGCTGTTTTTCGGATTTTTGAAGATGCGGTTAGTGGATAAATCATGAAGTAAGGCCAACTTTCTT TCTCTGTGCTCTGTTTCTATAAAACCAAATCCCCACATTATCCTCCGATCTCTCTTTCTCTCTCTTCTTCATCATTTCTTCCACAGATCTGTTTCTTTGGAGAGGGACAGCAACAATGGCGTCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATCGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTAGCGACGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGAGTTCTAGGATTGTAGCAATGTTGGCGCTGTTTTTCGGATTTTTGAAGATGCGGTTAGTGGATAAATCATGAAGTAAGGCCAACTTTCTT ATGGCGTCGTCGTCCTCCGATTCTACTCCTACGGCCTTCTCTGGCTTCTTCACATGCTTCGCTCTCATCTTCTTCATTCTATCGCCACTCGTTCACGCGCACTCTTCGGCTTCTGCTCCCGCTCCCGCTAGCGACGGGACCTCCATAGACCAGGGGATTGCGTACGTGTTGATGCTGATGGCGTTGGTTCTCACATATCTCATCCATCCTCTCGATGCATCTTCCTACCAATTTTTTCTGAATTGA MASSSSDSTPTAFSGFFTCFALIFFILSPLVHAHSSASAPAPASDGTSIDQGIAYVLMLMALVLTYLIHPLDASSYQFFLN
BLAST of Carg20869 vs. NCBI nr
Match: XP_022934029.1 (arabinogalactan peptide 20-like [Cucurbita moschata]) HSP 1 Score: 114.8 bits (286), Expect = 1.4e-22 Identity = 74/82 (90.24%), Postives = 74/82 (90.24%), Query Frame = 0
BLAST of Carg20869 vs. NCBI nr
Match: XP_023538848.1 (arabinogalactan peptide 20-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.8 bits (281), Expect = 5.3e-22 Identity = 72/81 (88.89%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Carg20869 vs. NCBI nr
Match: XP_022974647.1 (arabinogalactan peptide 16-like [Cucurbita maxima] >XP_022975026.1 arabinogalactan peptide 16-like [Cucurbita maxima]) HSP 1 Score: 103.2 bits (256), Expect = 4.2e-19 Identity = 68/81 (83.95%), Postives = 69/81 (85.19%), Query Frame = 0
BLAST of Carg20869 vs. NCBI nr
Match: XP_023528757.1 (arabinogalactan peptide 16-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 99.8 bits (247), Expect = 4.6e-18 Identity = 63/80 (78.75%), Postives = 67/80 (83.75%), Query Frame = 0
BLAST of Carg20869 vs. NCBI nr
Match: XP_022924337.1 (arabinogalactan peptide 16-like [Cucurbita moschata]) HSP 1 Score: 96.3 bits (238), Expect = 5.1e-17 Identity = 64/82 (78.05%), Postives = 68/82 (82.93%), Query Frame = 0
BLAST of Carg20869 vs. TAIR10
Match: AT3G61640.1 (arabinogalactan protein 20) HSP 1 Score: 70.9 bits (172), Expect = 4.2e-13 Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Carg20869 vs. TAIR10
Match: AT2G46330.1 (arabinogalactan protein 16) HSP 1 Score: 68.2 bits (165), Expect = 2.7e-12 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Carg20869 vs. TAIR10
Match: AT5G24105.1 (arabinogalactan protein 41) HSP 1 Score: 62.4 bits (150), Expect = 1.5e-10 Identity = 34/57 (59.65%), Postives = 39/57 (68.42%), Query Frame = 0
BLAST of Carg20869 vs. TAIR10
Match: AT5G53250.1 (arabinogalactan protein 22) HSP 1 Score: 51.2 bits (121), Expect = 3.4e-07 Identity = 36/50 (72.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of Carg20869 vs. Swiss-Prot
Match: sp|Q9M373|AGP20_ARATH (Arabinogalactan protein 20 OS=Arabidopsis thaliana OX=3702 GN=AGP20 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.6e-12 Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Carg20869 vs. Swiss-Prot
Match: sp|O82337|AGP16_ARATH (Arabinogalactan protein 16 OS=Arabidopsis thaliana OX=3702 GN=AGP16 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.9e-11 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Carg20869 vs. Swiss-Prot
Match: sp|Q8L9T8|AGP41_ARATH (Arabinogalactan protein 41 OS=Arabidopsis thaliana OX=3702 GN=AGP41 PE=1 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.7e-09 Identity = 34/57 (59.65%), Postives = 39/57 (68.42%), Query Frame = 0
BLAST of Carg20869 vs. Swiss-Prot
Match: sp|Q9FK16|AGP22_ARATH (Arabinogalactan protein 22 OS=Arabidopsis thaliana OX=3702 GN=AGP22 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.2e-06 Identity = 36/50 (72.00%), Postives = 40/50 (80.00%), Query Frame = 0
BLAST of Carg20869 vs. TrEMBL
Match: tr|A0A0A0L7A0|A0A0A0L7A0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G120410 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.7e-16 Identity = 60/77 (77.92%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of Carg20869 vs. TrEMBL
Match: tr|A0A061DUP4|A0A061DUP4_THECC (Arabinogalactan protein 20 OS=Theobroma cacao OX=3641 GN=TCM_005200 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 4.6e-14 Identity = 46/68 (67.65%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Carg20869 vs. TrEMBL
Match: tr|A0A2P5R746|A0A2P5R746_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD20468 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.9e-12 Identity = 51/67 (76.12%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of Carg20869 vs. TrEMBL
Match: tr|A0A1R3H1V1|A0A1R3H1V1_COCAP (Arabinogalactan peptide, AGP OS=Corchorus capsularis OX=210143 GN=CCACVL1_21839 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.6e-12 Identity = 52/68 (76.47%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of Carg20869 vs. TrEMBL
Match: tr|A0A1R3KNB5|A0A1R3KNB5_9ROSI (Arabinogalactan peptide, AGP OS=Corchorus olitorius OX=93759 GN=COLO4_06332 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.6e-12 Identity = 52/68 (76.47%), Postives = 55/68 (80.88%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|