Cla011701 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCATCCAACCCCAGCCTTGCTATGCTCTCCTCACCCTCAGCTTGTTCTTGTTCTTCATTCTTTCAAGCAATGTACAACCCATCCATTGCTTGACCTCATCCAAGAAGCTTGACGAATCCGCCGGTGGGAGTGATCCGAGCGTCAAGTGTACGCCGTGCACCAATTATCCGCCACCACCACCGCCACCGCCGAAGAAACCCCCACCAGCTTATTGCCCTCCGCCACCTCCTCCTCCGTCATCTTTCATATACATGCTCGGCCCGCCAGGAAACTTGTATCCCATTGACCAAGATTTCGCCGGTGCTAATCGGAGGACGATGGCCGTGGAGTGGACGGTGGTTGCTCTCTTTGGACTAATTGGGTTTATTGGTTTGTGGTGA ATGTGCATCCAACCCCAGCCTTGCTATGCTCTCCTCACCCTCAGCTTGTTCTTGTTCTTCATTCTTTCAAGCAATGTACAACCCATCCATTGCTTGACCTCATCCAAGAAGCTTGACGAATCCGCCGGTGGGAGTGATCCGAGCGTCAAGTGTACGCCGTGCACCAATTATCCGCCACCACCACCGCCACCGCCGAAGAAACCCCCACCAGCTTATTGCCCTCCGCCACCTCCTCCTCCGTCATCTTTCATATACATGCTCGGCCCGCCAGGAAACTTGTATCCCATTGACCAAGATTTCGCCGGTGCTAATCGGAGGACGATGGCCGTGGAGTGGACGGTGGTTGCTCTCTTTGGACTAATTGGGTTTATTGGTTTGTGGTGA ATGTGCATCCAACCCCAGCCTTGCTATGCTCTCCTCACCCTCAGCTTGTTCTTGTTCTTCATTCTTTCAAGCAATGTACAACCCATCCATTGCTTGACCTCATCCAAGAAGCTTGACGAATCCGCCGGTGGGAGTGATCCGAGCGTCAAGTGTACGCCGTGCACCAATTATCCGCCACCACCACCGCCACCGCCGAAGAAACCCCCACCAGCTTATTGCCCTCCGCCACCTCCTCCTCCGTCATCTTTCATATACATGCTCGGCCCGCCAGGAAACTTGTATCCCATTGACCAAGATTTCGCCGGTGCTAATCGGAGGACGATGGCCGTGGAGTGGACGGTGGTTGCTCTCTTTGGACTAATTGGGTTTATTGGTTTGTGGTGA MCIQPQPCYALLTLSLFLFFILSSNVQPIHCLTSSKKLDESAGGSDPSVKCTPCTNYPPPPPPPPKKPPPAYCPPPPPPPSSFIYMLGPPGNLYPIDQDFAGANRRTMAVEWTVVALFGLIGFIGLW
BLAST of Cla011701 vs. Swiss-Prot
Match: LRX6_ARATH (Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 6.0e-08 Identity = 27/57 (47.37%), Postives = 30/57 (52.63%), Query Frame = 1
HSP 2 Score: 56.2 bits (134), Expect = 3.0e-07 Identity = 25/48 (52.08%), Postives = 26/48 (54.17%), Query Frame = 1
HSP 3 Score: 55.1 bits (131), Expect = 6.6e-07 Identity = 23/40 (57.50%), Postives = 24/40 (60.00%), Query Frame = 1
HSP 4 Score: 50.1 bits (118), Expect = 2.1e-05 Identity = 22/38 (57.89%), Postives = 21/38 (55.26%), Query Frame = 1
HSP 5 Score: 47.4 bits (111), Expect = 1.4e-04 Identity = 22/42 (52.38%), Postives = 22/42 (52.38%), Query Frame = 1
BLAST of Cla011701 vs. Swiss-Prot
Match: LRX3_ARATH (Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.6e-07 Identity = 22/36 (61.11%), Postives = 20/36 (55.56%), Query Frame = 1
HSP 2 Score: 54.3 bits (129), Expect = 1.1e-06 Identity = 22/35 (62.86%), Postives = 21/35 (60.00%), Query Frame = 1
HSP 3 Score: 52.0 bits (123), Expect = 5.6e-06 Identity = 20/34 (58.82%), Postives = 19/34 (55.88%), Query Frame = 1
HSP 4 Score: 51.6 bits (122), Expect = 7.3e-06 Identity = 22/36 (61.11%), Postives = 20/36 (55.56%), Query Frame = 1
HSP 5 Score: 51.6 bits (122), Expect = 7.3e-06 Identity = 23/46 (50.00%), Postives = 23/46 (50.00%), Query Frame = 1
HSP 6 Score: 49.7 bits (117), Expect = 2.8e-05 Identity = 23/53 (43.40%), Postives = 22/53 (41.51%), Query Frame = 1
HSP 7 Score: 38.5 bits (88), Expect = 6.4e-02 Identity = 19/48 (39.58%), Postives = 20/48 (41.67%), Query Frame = 1
BLAST of Cla011701 vs. Swiss-Prot
Match: ZFHX4_HUMAN (Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.9e-06 Identity = 25/53 (47.17%), Postives = 26/53 (49.06%), Query Frame = 1
BLAST of Cla011701 vs. Swiss-Prot
Match: ALG13_HUMAN (Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens GN=ALG13 PE=1 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.9e-06 Identity = 22/38 (57.89%), Postives = 21/38 (55.26%), Query Frame = 1
HSP 2 Score: 46.2 bits (108), Expect = 3.1e-04 Identity = 22/55 (40.00%), Postives = 23/55 (41.82%), Query Frame = 1
BLAST of Cla011701 vs. Swiss-Prot
Match: PRR12_MOUSE (Proline-rich protein 12 OS=Mus musculus GN=Prr12 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.3e-06 Identity = 20/35 (57.14%), Postives = 21/35 (60.00%), Query Frame = 1
HSP 2 Score: 43.1 bits (100), Expect = 2.6e-03 Identity = 24/58 (41.38%), Postives = 27/58 (46.55%), Query Frame = 1
BLAST of Cla011701 vs. TrEMBL
Match: U5G8W7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s02110g PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 3.9e-06 Identity = 28/50 (56.00%), Postives = 29/50 (58.00%), Query Frame = 1
BLAST of Cla011701 vs. TrEMBL
Match: U5G8W7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s02110g PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.8e-04 Identity = 28/56 (50.00%), Postives = 29/56 (51.79%), Query Frame = 1
HSP 2 Score: 49.7 bits (117), Expect = 3.1e-03 Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
HSP 3 Score: 49.7 bits (117), Expect = 3.1e-03 Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
HSP 4 Score: 49.7 bits (117), Expect = 3.1e-03 Identity = 18/23 (78.26%), Postives = 18/23 (78.26%), Query Frame = 1
HSP 5 Score: 59.3 bits (142), Expect = 3.9e-06 Identity = 25/47 (53.19%), Postives = 27/47 (57.45%), Query Frame = 1
BLAST of Cla011701 vs. TrEMBL
Match: A0A163GJS0_DIDRA (Uncharacterized protein OS=Didymella rabiei GN=ST47_g3963 PE=4 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 7.4e-05 Identity = 29/72 (40.28%), Postives = 31/72 (43.06%), Query Frame = 1
HSP 2 Score: 48.1 bits (113), Expect = 9.0e-03 Identity = 19/29 (65.52%), Postives = 19/29 (65.52%), Query Frame = 1
HSP 3 Score: 59.3 bits (142), Expect = 3.9e-06 Identity = 32/75 (42.67%), Postives = 35/75 (46.67%), Query Frame = 1
BLAST of Cla011701 vs. TrEMBL
Match: V6F0M2_9PROT (Uncharacterized protein OS=Magnetospirillum gryphiswaldense MSR-1 v2 GN=MGMSRv2__1722 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.1e-04 Identity = 22/41 (53.66%), Postives = 25/41 (60.98%), Query Frame = 1
HSP 2 Score: 59.3 bits (142), Expect = 3.9e-06 Identity = 25/44 (56.82%), Postives = 28/44 (63.64%), Query Frame = 1
BLAST of Cla011701 vs. TrEMBL
Match: A0A0L7QNN2_9HYME (Uncharacterized protein (Fragment) OS=Habropoda laboriosa GN=WH47_09120 PE=4 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 4.8e-04 Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = 1
HSP 2 Score: 52.4 bits (124), Expect = 4.8e-04 Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = 1
HSP 3 Score: 51.6 bits (122), Expect = 8.2e-04 Identity = 23/44 (52.27%), Postives = 25/44 (56.82%), Query Frame = 1
HSP 4 Score: 51.6 bits (122), Expect = 8.2e-04 Identity = 23/44 (52.27%), Postives = 25/44 (56.82%), Query Frame = 1
HSP 5 Score: 50.1 bits (118), Expect = 2.4e-03 Identity = 24/50 (48.00%), Postives = 26/50 (52.00%), Query Frame = 1
HSP 6 Score: 49.3 bits (116), Expect = 4.0e-03 Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1
HSP 7 Score: 46.6 bits (109), Expect = 2.6e-02 Identity = 16/22 (72.73%), Postives = 17/22 (77.27%), Query Frame = 1
HSP 8 Score: 46.6 bits (109), Expect = 2.6e-02 Identity = 16/22 (72.73%), Postives = 17/22 (77.27%), Query Frame = 1
HSP 9 Score: 45.8 bits (107), Expect = 4.5e-02 Identity = 20/37 (54.05%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 10 Score: 45.8 bits (107), Expect = 4.5e-02 Identity = 20/37 (54.05%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 11 Score: 45.8 bits (107), Expect = 4.5e-02 Identity = 20/37 (54.05%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 12 Score: 45.1 bits (105), Expect = 7.6e-02 Identity = 27/62 (43.55%), Postives = 29/62 (46.77%), Query Frame = 1
HSP 13 Score: 44.7 bits (104), Expect = 1.0e-01 Identity = 17/22 (77.27%), Postives = 17/22 (77.27%), Query Frame = 1
HSP 14 Score: 43.9 bits (102), Expect = 1.7e-01 Identity = 19/31 (61.29%), Postives = 19/31 (61.29%), Query Frame = 1
HSP 15 Score: 43.9 bits (102), Expect = 1.7e-01 Identity = 19/31 (61.29%), Postives = 19/31 (61.29%), Query Frame = 1
HSP 16 Score: 42.7 bits (99), Expect = 3.8e-01 Identity = 16/23 (69.57%), Postives = 17/23 (73.91%), Query Frame = 1
HSP 17 Score: 58.9 bits (141), Expect = 5.1e-06 Identity = 25/44 (56.82%), Postives = 26/44 (59.09%), Query Frame = 1
BLAST of Cla011701 vs. NCBI nr
Match: gi|702274828|ref|XP_010044175.1| (PREDICTED: leucine-rich repeat extensin-like protein 2 [Eucalyptus grandis]) HSP 1 Score: 101.7 bits (252), Expect = 9.9e-19 Identity = 59/136 (43.38%), Postives = 71/136 (52.21%), Query Frame = 1
BLAST of Cla011701 vs. NCBI nr
Match: gi|685289915|ref|XP_009135898.1| (PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica rapa]) HSP 1 Score: 62.4 bits (150), Expect = 6.6e-07 Identity = 24/37 (64.86%), Postives = 26/37 (70.27%), Query Frame = 1
BLAST of Cla011701 vs. NCBI nr
Match: gi|685289915|ref|XP_009135898.1| (PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica rapa]) HSP 1 Score: 60.8 bits (146), Expect = 1.9e-06 Identity = 23/37 (62.16%), Postives = 25/37 (67.57%), Query Frame = 1
HSP 2 Score: 58.9 bits (141), Expect = 7.3e-06 Identity = 25/42 (59.52%), Postives = 28/42 (66.67%), Query Frame = 1
HSP 3 Score: 57.4 bits (137), Expect = 2.1e-05 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 4 Score: 54.7 bits (130), Expect = 1.4e-04 Identity = 19/23 (82.61%), Postives = 19/23 (82.61%), Query Frame = 1
HSP 5 Score: 54.7 bits (130), Expect = 1.4e-04 Identity = 19/23 (82.61%), Postives = 19/23 (82.61%), Query Frame = 1
HSP 6 Score: 54.3 bits (129), Expect = 1.8e-04 Identity = 19/24 (79.17%), Postives = 19/24 (79.17%), Query Frame = 1
HSP 7 Score: 54.3 bits (129), Expect = 1.8e-04 Identity = 19/24 (79.17%), Postives = 19/24 (79.17%), Query Frame = 1
HSP 8 Score: 53.9 bits (128), Expect = 2.4e-04 Identity = 24/48 (50.00%), Postives = 26/48 (54.17%), Query Frame = 1
HSP 9 Score: 52.4 bits (124), Expect = 6.9e-04 Identity = 23/48 (47.92%), Postives = 25/48 (52.08%), Query Frame = 1
HSP 10 Score: 51.2 bits (121), Expect = 1.5e-03 Identity = 20/28 (71.43%), Postives = 21/28 (75.00%), Query Frame = 1
HSP 11 Score: 51.2 bits (121), Expect = 1.5e-03 Identity = 20/28 (71.43%), Postives = 21/28 (75.00%), Query Frame = 1
HSP 12 Score: 50.8 bits (120), Expect = 2.0e-03 Identity = 21/42 (50.00%), Postives = 24/42 (57.14%), Query Frame = 1
HSP 13 Score: 48.5 bits (114), Expect = 9.9e-03 Identity = 21/37 (56.76%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 14 Score: 48.5 bits (114), Expect = 9.9e-03 Identity = 21/37 (56.76%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 15 Score: 48.5 bits (114), Expect = 9.9e-03 Identity = 20/37 (54.05%), Postives = 22/37 (59.46%), Query Frame = 1
HSP 16 Score: 48.5 bits (114), Expect = 9.9e-03 Identity = 24/62 (38.71%), Postives = 26/62 (41.94%), Query Frame = 1
HSP 17 Score: 47.8 bits (112), Expect = 1.7e-02 Identity = 23/49 (46.94%), Postives = 25/49 (51.02%), Query Frame = 1
HSP 18 Score: 47.0 bits (110), Expect = 2.9e-02 Identity = 21/39 (53.85%), Postives = 22/39 (56.41%), Query Frame = 1
HSP 19 Score: 47.0 bits (110), Expect = 2.9e-02 Identity = 21/39 (53.85%), Postives = 22/39 (56.41%), Query Frame = 1
HSP 20 Score: 46.2 bits (108), Expect = 4.9e-02 Identity = 20/38 (52.63%), Postives = 22/38 (57.89%), Query Frame = 1
HSP 21 Score: 45.4 bits (106), Expect = 8.4e-02 Identity = 21/40 (52.50%), Postives = 22/40 (55.00%), Query Frame = 1
HSP 22 Score: 45.1 bits (105), Expect = 1.1e-01 Identity = 18/33 (54.55%), Postives = 19/33 (57.58%), Query Frame = 1
HSP 23 Score: 45.1 bits (105), Expect = 1.1e-01 Identity = 16/22 (72.73%), Postives = 16/22 (72.73%), Query Frame = 1
HSP 24 Score: 45.1 bits (105), Expect = 1.1e-01 Identity = 18/33 (54.55%), Postives = 19/33 (57.58%), Query Frame = 1
HSP 25 Score: 44.3 bits (103), Expect = 1.9e-01 Identity = 22/49 (44.90%), Postives = 25/49 (51.02%), Query Frame = 1
HSP 26 Score: 41.6 bits (96), Expect = 1.2e+00 Identity = 23/52 (44.23%), Postives = 24/52 (46.15%), Query Frame = 1
HSP 27 Score: 41.2 bits (95), Expect = 1.6e+00 Identity = 19/38 (50.00%), Postives = 21/38 (55.26%), Query Frame = 1
HSP 28 Score: 40.8 bits (94), Expect = 2.1e+00 Identity = 18/37 (48.65%), Postives = 19/37 (51.35%), Query Frame = 1
HSP 29 Score: 39.7 bits (91), Expect = 4.6e+00 Identity = 18/42 (42.86%), Postives = 22/42 (52.38%), Query Frame = 1
HSP 30 Score: 60.1 bits (144), Expect = 3.3e-06 Identity = 31/64 (48.44%), Postives = 35/64 (54.69%), Query Frame = 1
BLAST of Cla011701 vs. NCBI nr
Match: gi|661897385|emb|CDO99097.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 46.2 bits (108), Expect = 4.9e-02 Identity = 19/39 (48.72%), Postives = 21/39 (53.85%), Query Frame = 1
HSP 2 Score: 44.7 bits (104), Expect = 1.4e-01 Identity = 20/34 (58.82%), Postives = 20/34 (58.82%), Query Frame = 1
HSP 3 Score: 40.0 bits (92), Expect = 3.5e+00 Identity = 20/47 (42.55%), Postives = 20/47 (42.55%), Query Frame = 1
HSP 4 Score: 59.7 bits (143), Expect = 4.3e-06 Identity = 22/33 (66.67%), Postives = 23/33 (69.70%), Query Frame = 1
BLAST of Cla011701 vs. NCBI nr
Match: gi|727416090|ref|XP_010513507.1| (PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina sativa]) HSP 1 Score: 52.4 bits (124), Expect = 6.9e-04 Identity = 24/44 (54.55%), Postives = 25/44 (56.82%), Query Frame = 1
HSP 2 Score: 51.2 bits (121), Expect = 1.5e-03 Identity = 22/44 (50.00%), Postives = 23/44 (52.27%), Query Frame = 1
HSP 3 Score: 50.4 bits (119), Expect = 2.6e-03 Identity = 19/23 (82.61%), Postives = 19/23 (82.61%), Query Frame = 1
HSP 4 Score: 44.3 bits (103), Expect = 1.9e-01 Identity = 21/49 (42.86%), Postives = 23/49 (46.94%), Query Frame = 1
HSP 5 Score: 42.4 bits (98), Expect = 7.1e-01 Identity = 21/49 (42.86%), Postives = 22/49 (44.90%), Query Frame = 1
HSP 6 Score: 41.6 bits (96), Expect = 1.2e+00 Identity = 18/33 (54.55%), Postives = 19/33 (57.58%), Query Frame = 1
HSP 7 Score: 37.7 bits (86), Expect = 1.7e+01 Identity = 17/37 (45.95%), Postives = 19/37 (51.35%), Query Frame = 1
HSP 8 Score: 59.3 bits (142), Expect = 5.6e-06 Identity = 25/44 (56.82%), Postives = 28/44 (63.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|