Carg26921 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGAAGTCGGTTTCGAATCCAGGAGCCTTGGGCTCCATGGACGAGGTCATGAAGATCTTCAAGAAGTTCGACAAGAACGGCGACGGCAAGATTTCTATTAGCGAGCTTGGCGCCGCCCTCGGCGAACTCGGCGGCAGAATCTCCTCGGACGAGATCCGCCGCATTATGTTAGAGATCGATACGGATGGCGATGGATTCATCGACCTTGACGAGTTCACCGCGTTTCATCAGGACGCCTATCCAGAGGGCGGAGGTAACAAAGATCTACAGGATGCTTTCGATCTGTACGATATGGACAAGAACGGCCTAATCTCGGCCAAGGAGTTGCACTTTGTTCTCAAGCGCCTCGGTGAAAAATGTAGCCTCAAAGATTGTTGCCGGATGATCAGTTCCGTCGATGTCGACGGCGATGGCCATGTAAATTTCGAGGAGTTCAAGAAGATGATGTCGCGCTCTTAG ATGGCGAAGAAGTCGGTTTCGAATCCAGGAGCCTTGGGCTCCATGGACGAGGTCATGAAGATCTTCAAGAAGTTCGACAAGAACGGCGACGGCAAGATTTCTATTAGCGAGCTTGGCGCCGCCCTCGGCGAACTCGGCGGCAGAATCTCCTCGGACGAGATCCGCCGCATTATGTTAGAGATCGATACGGATGGCGATGGATTCATCGACCTTGACGAGTTCACCGCGTTTCATCAGGACGCCTATCCAGAGGGCGGAGGTAACAAAGATCTACAGGATGCTTTCGATCTGTACGATATGGACAAGAACGGCCTAATCTCGGCCAAGGAGTTGCACTTTGTTCTCAAGCGCCTCGGTGAAAAATGTAGCCTCAAAGATTGTTGCCGGATGATCAGTTCCGTCGATGTCGACGGCGATGGCCATGTAAATTTCGAGGAGTTCAAGAAGATGATGTCGCGCTCTTAG ATGGCGAAGAAGTCGGTTTCGAATCCAGGAGCCTTGGGCTCCATGGACGAGGTCATGAAGATCTTCAAGAAGTTCGACAAGAACGGCGACGGCAAGATTTCTATTAGCGAGCTTGGCGCCGCCCTCGGCGAACTCGGCGGCAGAATCTCCTCGGACGAGATCCGCCGCATTATGTTAGAGATCGATACGGATGGCGATGGATTCATCGACCTTGACGAGTTCACCGCGTTTCATCAGGACGCCTATCCAGAGGGCGGAGGTAACAAAGATCTACAGGATGCTTTCGATCTGTACGATATGGACAAGAACGGCCTAATCTCGGCCAAGGAGTTGCACTTTGTTCTCAAGCGCCTCGGTGAAAAATGTAGCCTCAAAGATTGTTGCCGGATGATCAGTTCCGTCGATGTCGACGGCGATGGCCATGTAAATTTCGAGGAGTTCAAGAAGATGATGTCGCGCTCTTAG MAKKSVSNPGALGSMDEVMKIFKKFDKNGDGKISISELGAALGELGGRISSDEIRRIMLEIDTDGDGFIDLDEFTAFHQDAYPEGGGNKDLQDAFDLYDMDKNGLISAKELHFVLKRLGEKCSLKDCCRMISSVDVDGDGHVNFEEFKKMMSRS
BLAST of Carg26921 vs. NCBI nr
Match: XP_022934113.1 (calcium-binding protein CML24-like [Cucurbita moschata]) HSP 1 Score: 241.9 bits (616), Expect = 1.4e-60 Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 0
BLAST of Carg26921 vs. NCBI nr
Match: XP_023526443.1 (calcium-binding protein CML24-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 241.9 bits (616), Expect = 1.4e-60 Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 0
BLAST of Carg26921 vs. NCBI nr
Match: XP_022983538.1 (calcium-binding protein CML24-like [Cucurbita maxima]) HSP 1 Score: 235.3 bits (599), Expect = 1.3e-58 Identity = 148/154 (96.10%), Postives = 152/154 (98.70%), Query Frame = 0
BLAST of Carg26921 vs. NCBI nr
Match: XP_022143269.1 (probable calcium-binding protein CML23 [Momordica charantia]) HSP 1 Score: 206.8 bits (525), Expect = 5.1e-50 Identity = 137/160 (85.62%), Postives = 143/160 (89.38%), Query Frame = 0
BLAST of Carg26921 vs. NCBI nr
Match: XP_022948508.1 (probable calcium-binding protein CML23 [Cucurbita moschata] >XP_023524703.1 probable calcium-binding protein CML23 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 203.4 bits (516), Expect = 5.7e-49 Identity = 134/160 (83.75%), Postives = 141/160 (88.12%), Query Frame = 0
BLAST of Carg26921 vs. TAIR10
Match: AT1G18210.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 114.4 bits (285), Expect = 6.3e-26 Identity = 61/143 (42.66%), Postives = 79/143 (55.24%), Query Frame = 0
BLAST of Carg26921 vs. TAIR10
Match: AT1G73630.1 (EF hand calcium-binding protein family) HSP 1 Score: 107.5 bits (267), Expect = 7.7e-24 Identity = 84/136 (61.76%), Postives = 99/136 (72.79%), Query Frame = 0
BLAST of Carg26921 vs. TAIR10
Match: AT1G24620.1 (EF hand calcium-binding protein family) HSP 1 Score: 102.1 bits (253), Expect = 3.2e-22 Identity = 55/136 (40.44%), Postives = 75/136 (55.15%), Query Frame = 0
BLAST of Carg26921 vs. TAIR10
Match: AT1G66400.1 (calmodulin like 23) HSP 1 Score: 97.8 bits (242), Expect = 6.1e-21 Identity = 88/150 (58.67%), Postives = 103/150 (68.67%), Query Frame = 0
BLAST of Carg26921 vs. TAIR10
Match: AT2G36180.1 (EF hand calcium-binding protein family) HSP 1 Score: 90.5 bits (223), Expect = 9.7e-19 Identity = 56/139 (40.29%), Postives = 70/139 (50.36%), Query Frame = 0
BLAST of Carg26921 vs. Swiss-Prot
Match: sp|Q9M7R0|ALL8_OLEEU (Calcium-binding allergen Ole e 8 OS=Olea europaea OX=4146 PE=1 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.1e-24 Identity = 63/140 (45.00%), Postives = 77/140 (55.00%), Query Frame = 0
BLAST of Carg26921 vs. Swiss-Prot
Match: sp|Q9LE22|CML27_ARATH (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana OX=3702 GN=CML27 PE=1 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.1e-24 Identity = 61/143 (42.66%), Postives = 79/143 (55.24%), Query Frame = 0
BLAST of Carg26921 vs. Swiss-Prot
Match: sp|Q0DJV6|CML18_ORYSJ (Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica OX=39947 GN=CML18 PE=2 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 3.3e-24 Identity = 63/149 (42.28%), Postives = 80/149 (53.69%), Query Frame = 0
BLAST of Carg26921 vs. Swiss-Prot
Match: sp|Q9C9U8|CML26_ARATH (Probable calcium-binding protein CML26 OS=Arabidopsis thaliana OX=3702 GN=CML26 PE=1 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.4e-22 Identity = 84/136 (61.76%), Postives = 99/136 (72.79%), Query Frame = 0
BLAST of Carg26921 vs. Swiss-Prot
Match: sp|Q9FYK2|CML25_ARATH (Probable calcium-binding protein CML25 OS=Arabidopsis thaliana OX=3702 GN=CML25 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 5.8e-21 Identity = 55/136 (40.44%), Postives = 75/136 (55.15%), Query Frame = 0
BLAST of Carg26921 vs. TrEMBL
Match: tr|A0A1S3C5W9|A0A1S3C5W9_CUCME (probable calcium-binding protein CML27 OS=Cucumis melo OX=3656 GN=LOC103496821 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 2.1e-44 Identity = 126/152 (82.89%), Postives = 135/152 (88.82%), Query Frame = 0
BLAST of Carg26921 vs. TrEMBL
Match: tr|A0A0A0LCM1|A0A0A0LCM1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G319280 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.5e-42 Identity = 121/152 (79.61%), Postives = 130/152 (85.53%), Query Frame = 0
BLAST of Carg26921 vs. TrEMBL
Match: tr|A0A2P5E778|A0A2P5E778_9ROSA (Parvalbumin OS=Trema orientalis OX=63057 GN=TorRG33x02_228270 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 1.3e-33 Identity = 100/164 (60.98%), Postives = 112/164 (68.29%), Query Frame = 0
BLAST of Carg26921 vs. TrEMBL
Match: tr|A0A2P5BY36|A0A2P5BY36_PARAD (Parvalbumin OS=Parasponia andersonii OX=3476 GN=PanWU01x14_200320 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 2.9e-33 Identity = 102/164 (62.20%), Postives = 112/164 (68.29%), Query Frame = 0
BLAST of Carg26921 vs. TrEMBL
Match: tr|A0A166AVJ5|A0A166AVJ5_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_010743 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.1e-32 Identity = 100/142 (70.42%), Postives = 114/142 (80.28%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: None |