Carg12823 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCTCATTCCTCTCATCGTTCTTCCTTCCTTGTTCCTTTGATCTCTTTCGCGCGTTCTTGGTCTTTAGCTTTCTGGTGAGTTTCTGGTTCCTTCTGAATTCGTAGATTTTGTTCTTCCTTAGCCTGGATTTTCTTCTTTTTGTTTGTTTATGTCTGAGATTGATCGTGGTTAGGGTTTTGTTTATATCTCTTTGACTTTTGTGTTTTTTCTCGCAATTCCGAATTTGTTTGGTAAGATTCTGGTGTTGCTTCGTTTATGGAAGCCATGGATATTGCTTCGTTTGTATCCTGCTGGAATTTTGTCTTTCTTTCATGTTGTCAAGGGTTTTTTTATACGAGACGCATGTTTTGATCACTTAGGTCTCCAGTTAAGTCGTGGATGAATTGGATATTGCGAATTTTTGCTATATGTAAATTCTGGAGTTTTTGTTATGCCTTTCTCTCAATCCCGAATGTTTTCAGATCACCAGTTGTTCTGTTTGGTTTGAGCTTCATCCGAACTTGATTTTTGGCTATTTGTAAATTTCGGAGTTTTTGTTATGCCTTTCTCTGAATCCCGTCAGATTACCTGTTGTTCTGTTTGGTTTGAGCTTCATACTAACTTGATTTTCGGCTATATGTAAACTTTGAAGTTTTTGATATGCCTTCCTCTAAATCCCATATGCTTTCAGATTCGCAGTTGTTCAGTTTGGTTTAAAGCTTCATCCAAACAAAGTTCATGGTTGAATTAGACTTCCAGATCCCATCTGCTTTCGATCCATTCGCCGACGCCAAGGATTCTGATGCCCCCGGAACTAAAGCTTATGTTCATATCCGCGTTCAGCAGAGGAATGGCAAAAAGTGCTTGACTACAGTTCAGGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAGGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTTCAAGACAAAGAATTGGGGAAGATAATCCAACTTCAAGGCGATCAACGCAAAAACGTGTCTCAGTTCCTTGTCCAGGCTGGTCTCGTTAAGAAGGATCAGATCAAAATTCATGGGTTTTGA ATGTTCTCATTCCTCTCATCGTTCTTCCTTCCTTGTTCCTTTGATCTCTTTCGCGCGTTCTTGGTCTTTAGCTTTCTGATCCCATCTGCTTTCGATCCATTCGCCGACGCCAAGGATTCTGATGCCCCCGGAACTAAAGCTTATGTTCATATCCGCGTTCAGCAGAGGAATGGCAAAAAGTGCTTGACTACAGTTCAGGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAGGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTTCAAGACAAAGAATTGGGGAAGATAATCCAACTTCAAGGCGATCAACGCAAAAACGTGTCTCAGTTCCTTGTCCAGGCTGGTCTCGTTAAGAAGGATCAGATCAAAATTCATGGGTTTTGA ATGTTCTCATTCCTCTCATCGTTCTTCCTTCCTTGTTCCTTTGATCTCTTTCGCGCGTTCTTGGTCTTTAGCTTTCTGATCCCATCTGCTTTCGATCCATTCGCCGACGCCAAGGATTCTGATGCCCCCGGAACTAAAGCTTATGTTCATATCCGCGTTCAGCAGAGGAATGGCAAAAAGTGCTTGACTACAGTTCAGGGTCTGAAGAAAGAGTTCAGCTACGAGAAGATCCTTAAGGACGTGAAGAAGGAATTCTGCTGTAATGGTAACGTTGTTCAAGACAAAGAATTGGGGAAGATAATCCAACTTCAAGGCGATCAACGCAAAAACGTGTCTCAGTTCCTTGTCCAGGCTGGTCTCGTTAAGAAGGATCAGATCAAAATTCATGGGTTTTGA MFSFLSSFFLPCSFDLFRAFLVFSFLIPSAFDPFADAKDSDAPGTKAYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILKDVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF
BLAST of Carg12823 vs. NCBI nr
Match: XP_022976609.1 (protein translation factor SUI1 homolog 1 [Cucurbita maxima] >XP_022976610.1 protein translation factor SUI1 homolog 1 [Cucurbita maxima]) HSP 1 Score: 215.7 bits (548), Expect = 9.4e-53 Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of Carg12823 vs. NCBI nr
Match: XP_022936190.1 (protein translation factor SUI1 homolog 1 [Cucurbita moschata]) HSP 1 Score: 214.5 bits (545), Expect = 2.1e-52 Identity = 105/107 (98.13%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of Carg12823 vs. NCBI nr
Match: XP_023536045.1 (protein translation factor SUI1 homolog 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 214.5 bits (545), Expect = 2.1e-52 Identity = 105/107 (98.13%), Postives = 106/107 (99.07%), Query Frame = 0
BLAST of Carg12823 vs. NCBI nr
Match: XP_004139787.1 (PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis sativus] >XP_008447738.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis melo] >XP_011658975.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis sativus] >KGN44162.1 hypothetical protein Csa_7G209580 [Cucumis sativus]) HSP 1 Score: 213.8 bits (543), Expect = 3.6e-52 Identity = 105/107 (98.13%), Postives = 105/107 (98.13%), Query Frame = 0
BLAST of Carg12823 vs. NCBI nr
Match: XP_011650527.1 (PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis sativus] >XP_016903023.1 PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis melo] >KGN56126.1 hypothetical protein Csa_3G077610 [Cucumis sativus]) HSP 1 Score: 209.1 bits (531), Expect = 8.8e-51 Identity = 101/105 (96.19%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Carg12823 vs. TAIR10
Match: AT5G54940.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 189.1 bits (479), Expect = 1.7e-48 Identity = 89/105 (84.76%), Postives = 98/105 (93.33%), Query Frame = 0
BLAST of Carg12823 vs. TAIR10
Match: AT1G54290.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 176.0 bits (445), Expect = 1.5e-44 Identity = 86/106 (81.13%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. TAIR10
Match: AT4G27130.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 175.6 bits (444), Expect = 2.0e-44 Identity = 86/106 (81.13%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. TAIR10
Match: AT5G54760.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 175.3 bits (443), Expect = 2.6e-44 Identity = 86/106 (81.13%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. Swiss-Prot
Match: sp|Q94JV4|SUI12_ARATH (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At1g54290 PE=3 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.7e-43 Identity = 86/106 (81.13%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. Swiss-Prot
Match: sp|P41568|SUI11_ARATH (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27130 PE=1 SV=2) HSP 1 Score: 175.6 bits (444), Expect = 3.5e-43 Identity = 86/106 (81.13%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. Swiss-Prot
Match: sp|Q9SQF4|SUI1_BRAOL (Protein translation factor SUI1 homolog OS=Brassica oleracea OX=3712 PE=3 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 1.0e-42 Identity = 85/106 (80.19%), Postives = 94/106 (88.68%), Query Frame = 0
BLAST of Carg12823 vs. Swiss-Prot
Match: sp|P56330|SUI1_MAIZE (Protein translation factor SUI1 homolog OS=Zea mays OX=4577 GN=TIF PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 6.6e-42 Identity = 83/108 (76.85%), Postives = 94/108 (87.04%), Query Frame = 0
BLAST of Carg12823 vs. Swiss-Prot
Match: sp|A6MZM2|SUI1_ORYSI (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica OX=39946 GN=GOS2 PE=2 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 6.6e-42 Identity = 83/108 (76.85%), Postives = 94/108 (87.04%), Query Frame = 0
BLAST of Carg12823 vs. TrEMBL
Match: tr|A0A1S3BI45|A0A1S3BI45_CUCME (protein translation factor SUI1 homolog 1-like OS=Cucumis melo OX=3656 GN=LOC103490142 PE=4 SV=1) HSP 1 Score: 213.8 bits (543), Expect = 2.4e-52 Identity = 105/107 (98.13%), Postives = 105/107 (98.13%), Query Frame = 0
BLAST of Carg12823 vs. TrEMBL
Match: tr|A0A0A0K771|A0A0A0K771_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G209580 PE=4 SV=1) HSP 1 Score: 213.8 bits (543), Expect = 2.4e-52 Identity = 105/107 (98.13%), Postives = 105/107 (98.13%), Query Frame = 0
BLAST of Carg12823 vs. TrEMBL
Match: tr|A0A1S4E468|A0A1S4E468_CUCME (protein translation factor SUI1 homolog 2 OS=Cucumis melo OX=3656 GN=LOC103501585 PE=4 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 5.8e-51 Identity = 101/105 (96.19%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Carg12823 vs. TrEMBL
Match: tr|A0A0A0L7M8|A0A0A0L7M8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G077610 PE=4 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 5.8e-51 Identity = 101/105 (96.19%), Postives = 104/105 (99.05%), Query Frame = 0
BLAST of Carg12823 vs. TrEMBL
Match: tr|A0A2P4N5H0|A0A2P4N5H0_QUESU (Protein translation factor sui1 like 2 OS=Quercus suber OX=58331 GN=CFP56_77547 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 4.6e-48 Identity = 94/105 (89.52%), Postives = 101/105 (96.19%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|