CsGy7G009290 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGAATTAGATTTCCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAAAGATTCGGATGCCCCCGGAACGAAGGAGTATGTTCATATTCGCGTCCAGCAAAGGAACGGAAAGAAGTGCTTGACAACAGTTCAAGGTCTGAAAAAAGAGTTCAGCTACGAGAAGATTCTCAAAGACGTGAAGAAGGAGTTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAACGCAAGAACGTCTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAAGATCAGATCAAGATCCATGGATTTTAA ATGGTTGAATTAGATTTCCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAAAGATTCGGATGCCCCCGGAACGAAGGAGTATGTTCATATTCGCGTCCAGCAAAGGAACGGAAAGAAGTGCTTGACAACAGTTCAAGGTCTGAAAAAAGAGTTCAGCTACGAGAAGATTCTCAAAGACGTGAAGAAGGAGTTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAACGCAAGAACGTCTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAAGATCAGATCAAGATCCATGGATTTTAA ATGGTTGAATTAGATTTCCAGATCCCATCTGCATTTGATCCATTTGCCGACGCCAAAGATTCGGATGCCCCCGGAACGAAGGAGTATGTTCATATTCGCGTCCAGCAAAGGAACGGAAAGAAGTGCTTGACAACAGTTCAAGGTCTGAAAAAAGAGTTCAGCTACGAGAAGATTCTCAAAGACGTGAAGAAGGAGTTCTGCTGTAATGGTAACGTTGTGCAAGACAAAGAATTGGGGAAGATAATTCAACTTCAGGGTGATCAACGCAAGAACGTCTCTCAGTTTCTTGTTCAGGCTGGTCTTGTCAAGAAAGATCAGATCAAGATCCATGGATTTTAA MVELDFQIPSAFDPFADAKDSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKILKDVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF
BLAST of CsGy7G009290 vs. NCBI nr
Match: XP_004139787.1 (PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis sativus] >XP_008447738.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis melo] >XP_011658975.1 PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis sativus] >KGN44162.1 hypothetical protein Csa_7G209580 [Cucumis sativus]) HSP 1 Score: 228.4 bits (581), Expect = 1.2e-56 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of CsGy7G009290 vs. NCBI nr
Match: XP_022976609.1 (protein translation factor SUI1 homolog 1 [Cucurbita maxima] >XP_022976610.1 protein translation factor SUI1 homolog 1 [Cucurbita maxima]) HSP 1 Score: 226.1 bits (575), Expect = 5.9e-56 Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. NCBI nr
Match: XP_022936190.1 (protein translation factor SUI1 homolog 1 [Cucurbita moschata]) HSP 1 Score: 224.9 bits (572), Expect = 1.3e-55 Identity = 110/112 (98.21%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. NCBI nr
Match: XP_023536045.1 (protein translation factor SUI1 homolog 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 224.9 bits (572), Expect = 1.3e-55 Identity = 110/112 (98.21%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. NCBI nr
Match: XP_011650527.1 (PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis sativus] >XP_016903023.1 PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis melo] >KGN56126.1 hypothetical protein Csa_3G077610 [Cucumis sativus]) HSP 1 Score: 221.1 bits (562), Expect = 1.9e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. TAIR10
Match: AT5G54940.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 202.6 bits (514), Expect = 1.3e-52 Identity = 96/112 (85.71%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of CsGy7G009290 vs. TAIR10
Match: AT4G27130.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 186.0 bits (471), Expect = 1.2e-47 Identity = 92/113 (81.42%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. TAIR10
Match: AT5G54760.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 185.7 bits (470), Expect = 1.6e-47 Identity = 92/113 (81.42%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. TAIR10
Match: AT1G54290.1 (Translation initiation factor SUI1 family protein) HSP 1 Score: 184.1 bits (466), Expect = 4.7e-47 Identity = 90/113 (79.65%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. Swiss-Prot
Match: sp|P41568|SUI11_ARATH (Protein translation factor SUI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=At4g27130 PE=1 SV=2) HSP 1 Score: 186.0 bits (471), Expect = 2.2e-46 Identity = 92/113 (81.42%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. Swiss-Prot
Match: sp|Q9SQF4|SUI1_BRAOL (Protein translation factor SUI1 homolog OS=Brassica oleracea OX=3712 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 6.5e-46 Identity = 91/113 (80.53%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. Swiss-Prot
Match: sp|Q94JV4|SUI12_ARATH (Protein translation factor SUI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At1g54290 PE=3 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.5e-46 Identity = 90/113 (79.65%), Postives = 100/113 (88.50%), Query Frame = 0
BLAST of CsGy7G009290 vs. Swiss-Prot
Match: sp|P56330|SUI1_MAIZE (Protein translation factor SUI1 homolog OS=Zea mays OX=4577 GN=TIF PE=3 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 9.4e-45 Identity = 87/115 (75.65%), Postives = 100/115 (86.96%), Query Frame = 0
BLAST of CsGy7G009290 vs. Swiss-Prot
Match: sp|A6MZM2|SUI1_ORYSI (Protein translation factor SUI1 homolog OS=Oryza sativa subsp. indica OX=39946 GN=GOS2 PE=2 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 9.4e-45 Identity = 87/115 (75.65%), Postives = 100/115 (86.96%), Query Frame = 0
BLAST of CsGy7G009290 vs. TrEMBL
Match: tr|A0A1S3BI45|A0A1S3BI45_CUCME (protein translation factor SUI1 homolog 1-like OS=Cucumis melo OX=3656 GN=LOC103490142 PE=4 SV=1) HSP 1 Score: 228.4 bits (581), Expect = 7.9e-57 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of CsGy7G009290 vs. TrEMBL
Match: tr|A0A0A0K771|A0A0A0K771_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G209580 PE=4 SV=1) HSP 1 Score: 228.4 bits (581), Expect = 7.9e-57 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 0
BLAST of CsGy7G009290 vs. TrEMBL
Match: tr|A0A1S4E468|A0A1S4E468_CUCME (protein translation factor SUI1 homolog 2 OS=Cucumis melo OX=3656 GN=LOC103501585 PE=4 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 1.3e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. TrEMBL
Match: tr|A0A0A0L7M8|A0A0A0L7M8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G077610 PE=4 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 1.3e-54 Identity = 107/112 (95.54%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy7G009290 vs. TrEMBL
Match: tr|A0A2P5F2H3|A0A2P5F2H3_9ROSA (Eukaryotic translation initiation factor SUI OS=Trema orientalis OX=63057 GN=TorRG33x02_123180 PE=4 SV=1) HSP 1 Score: 211.5 bits (537), Expect = 1.0e-51 Identity = 102/112 (91.07%), Postives = 108/112 (96.43%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |