Carg10239 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTCTGCGTTAGCTCAAGTGATAACGAGTGGGAGTGGGAGTAGCAGAAGCCCAGTAGAAGCAGATTACTGGCCGCAATCGCAGCAAGCAGCAGCAGATGAAGAACAAGGTGGTGGAAGCAGGACGGGGATGGTGTCAAGAGAGAGGCATTATCGAGGAGTAAGGCAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCGAAAAAGGCAGCAAGAGTGTGGCTGGGCACCTTCGACACTGCTGAGGCTGCCGCACTTGCTTACGATGAAGCTGCCCTCAGATTCAAAGGCACCAAAGCCAAGCTCAACTTCCCTGAGAGACTCACTACCCCATGCCCTCCGCCCCCCTATGCCTATCATCACCATCACAATAACCACAACCTATAG ATGGTTTCTGCGTTAGCTCAAGTGATAACGAGTGGGAGTGGGAGTAGCAGAAGCCCAGTAGAAGCAGATTACTGGCCGCAATCGCAGCAAGCAGCAGCAGATGAAGAACAAGGTGGTGGAAGCAGGACGGGGATGGTGTCAAGAGAGAGGCATTATCGAGGAGTAAGGCAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCGAAAAAGGCAGCAAGAGTGTGGCTGGGCACCTTCGACACTGCTGAGGCTGCCGCACTTGCTTACGATGAAGCTGCCCTCAGATTCAAAGGCACCAAAGCCAAGCTCAACTTCCCTGAGAGACTCACTACCCCATGCCCTCCGCCCCCCTATGCCTATCATCACCATCACAATAACCACAACCTATAG ATGGTTTCTGCGTTAGCTCAAGTGATAACGAGTGGGAGTGGGAGTAGCAGAAGCCCAGTAGAAGCAGATTACTGGCCGCAATCGCAGCAAGCAGCAGCAGATGAAGAACAAGGTGGTGGAAGCAGGACGGGGATGGTGTCAAGAGAGAGGCATTATCGAGGAGTAAGGCAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCGAAAAAGGCAGCAAGAGTGTGGCTGGGCACCTTCGACACTGCTGAGGCTGCCGCACTTGCTTACGATGAAGCTGCCCTCAGATTCAAAGGCACCAAAGCCAAGCTCAACTTCCCTGAGAGACTCACTACCCCATGCCCTCCGCCCCCCTATGCCTATCATCACCATCACAATAACCACAACCTATAG MVSALAQVITSGSGSSRSPVEADYWPQSQQAAADEEQGGGSRTGMVSRERHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGTKAKLNFPERLTTPCPPPPYAYHHHHNNHNL
BLAST of Carg10239 vs. NCBI nr
Match: XP_022921378.1 (ethylene-responsive transcription factor ERF114-like, partial [Cucurbita moschata]) HSP 1 Score: 226.9 bits (577), Expect = 4.1e-56 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 0
BLAST of Carg10239 vs. NCBI nr
Match: XP_023516838.1 (ethylene-responsive transcription factor ERF115-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 220.3 bits (560), Expect = 3.8e-54 Identity = 113/116 (97.41%), Postives = 114/116 (98.28%), Query Frame = 0
BLAST of Carg10239 vs. NCBI nr
Match: XP_022987260.1 (ethylene-responsive transcription factor ERF115-like [Cucurbita maxima]) HSP 1 Score: 219.2 bits (557), Expect = 8.5e-54 Identity = 113/116 (97.41%), Postives = 113/116 (97.41%), Query Frame = 0
BLAST of Carg10239 vs. NCBI nr
Match: XP_004138017.1 (PREDICTED: ethylene-responsive transcription factor ERF115 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 4.1e-32 Identity = 80/114 (70.18%), Postives = 84/114 (73.68%), Query Frame = 0
BLAST of Carg10239 vs. NCBI nr
Match: XP_008464362.1 (PREDICTED: ethylene-responsive transcription factor ERF115 [Cucumis melo] >ADN33855.1 AP2 domain transcription factor RAP2.3 [Cucumis melo subsp. melo]) HSP 1 Score: 144.8 bits (364), Expect = 2.0e-31 Identity = 79/114 (69.30%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TAIR10
Match: AT5G61890.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 129.0 bits (323), Expect = 2.1e-30 Identity = 75/121 (61.98%), Postives = 86/121 (71.07%), Query Frame = 0
BLAST of Carg10239 vs. TAIR10
Match: AT5G07310.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 128.6 bits (322), Expect = 2.7e-30 Identity = 72/114 (63.16%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TAIR10
Match: AT5G13330.1 (related to AP2 6l) HSP 1 Score: 127.9 bits (320), Expect = 4.7e-30 Identity = 72/114 (63.16%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TAIR10
Match: AT2G33710.2 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 116.7 bits (291), Expect = 1.1e-26 Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 0
BLAST of Carg10239 vs. TAIR10
Match: AT5G50080.1 (ethylene response factor 110) HSP 1 Score: 114.0 bits (284), Expect = 7.0e-26 Identity = 62/95 (65.26%), Postives = 69/95 (72.63%), Query Frame = 0
BLAST of Carg10239 vs. Swiss-Prot
Match: sp|Q9FH54|EF114_ARATH (Ethylene-responsive transcription factor ERF114 OS=Arabidopsis thaliana OX=3702 GN=ERF114 PE=1 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.8e-29 Identity = 75/121 (61.98%), Postives = 86/121 (71.07%), Query Frame = 0
BLAST of Carg10239 vs. Swiss-Prot
Match: sp|Q9LY29|EF115_ARATH (Ethylene-responsive transcription factor ERF115 OS=Arabidopsis thaliana OX=3702 GN=ERF115 PE=1 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 4.9e-29 Identity = 72/114 (63.16%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. Swiss-Prot
Match: sp|Q9LYU3|EF113_ARATH (Ethylene-responsive transcription factor ERF113 OS=Arabidopsis thaliana OX=3702 GN=ERF113 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 8.4e-29 Identity = 72/114 (63.16%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. Swiss-Prot
Match: sp|P93007|EF112_ARATH (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana OX=3702 GN=ERF112 PE=1 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.9e-25 Identity = 54/65 (83.08%), Postives = 59/65 (90.77%), Query Frame = 0
BLAST of Carg10239 vs. Swiss-Prot
Match: sp|Q70II3|EF110_ARATH (Ethylene-responsive transcription factor ERF110 OS=Arabidopsis thaliana OX=3702 GN=ERF110 PE=2 SV=2) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-24 Identity = 62/95 (65.26%), Postives = 69/95 (72.63%), Query Frame = 0
BLAST of Carg10239 vs. TrEMBL
Match: tr|A0A1S3CLA5|A0A1S3CLA5_CUCME (ethylene-responsive transcription factor ERF115 OS=Cucumis melo OX=3656 GN=LOC103502272 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 1.3e-31 Identity = 79/114 (69.30%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TrEMBL
Match: tr|E5GBL4|E5GBL4_CUCME (AP2 domain transcription factor RAP2.3 OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 1.3e-31 Identity = 79/114 (69.30%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TrEMBL
Match: tr|A0A0A0LTV8|A0A0A0LTV8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G000550 PE=4 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.0e-31 Identity = 79/114 (69.30%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Carg10239 vs. TrEMBL
Match: tr|A0A2I4FMK5|A0A2I4FMK5_9ROSI (ethylene-responsive transcription factor ERF114-like OS=Juglans regia OX=51240 GN=LOC109000456 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 3.3e-30 Identity = 79/115 (68.70%), Postives = 87/115 (75.65%), Query Frame = 0
BLAST of Carg10239 vs. TrEMBL
Match: tr|A0A164XF47|A0A164XF47_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_016339 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 4.3e-30 Identity = 78/119 (65.55%), Postives = 87/119 (73.11%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|