Cla97C06G128180 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGCCATGGTTTGTGCGTTAGGTGAAGTGATAAGGAGTGGGAGTAGCAAAAGCCCAGCGGTAGTTGAAGCAGATTATTGGCCAGAATCGGAATCGCAATCGCAGCGAGCAGATCATGAAGAAGAAGTGAAAAGAGAGAGTCGGCATTATCGAGGAGTAAGACAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCAAAAAAGGCAGCAAGAGTGTGGCTAGGCACCTTCGACACTGCTGAGGCTGCAGCACTTGCTTACGATGAAGCTGCCCTTAGATTCAAAGGCACAAAAGCCAAGCTCAACTTCCCTGAGAGGCTCACCACTCCACCCTCCTATGCCTATCATCATCCCACCTTTATGCTCAATCTCCACTCCTCAACTTCTCATCCTTCCCATCATCAGGACCACAAAAACTAA ATGTCAGCCATGGTTTGTGCGTTAGGTGAAGTGATAAGGAGTGGGAGTAGCAAAAGCCCAGCGGTAGTTGAAGCAGATTATTGGCCAGAATCGGAATCGCAATCGCAGCGAGCAGATCATGAAGAAGAAGTGAAAAGAGAGAGTCGGCATTATCGAGGAGTAAGACAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCAAAAAAGGCAGCAAGAGTGTGGCTAGGCACCTTCGACACTGCTGAGGCTGCAGCACTTGCTTACGATGAAGCTGCCCTTAGATTCAAAGGCACAAAAGCCAAGCTCAACTTCCCTGAGAGGCTCACCACTCCACCCTCCTATGCCTATCATCATCCCACCTTTATGCTCAATCTCCACTCCTCAACTTCTCATCCTTCCCATCATCAGGACCACAAAAACTAA ATGTCAGCCATGGTTTGTGCGTTAGGTGAAGTGATAAGGAGTGGGAGTAGCAAAAGCCCAGCGGTAGTTGAAGCAGATTATTGGCCAGAATCGGAATCGCAATCGCAGCGAGCAGATCATGAAGAAGAAGTGAAAAGAGAGAGTCGGCATTATCGAGGAGTAAGACAGAGACCGTGGGGAAAATGGGCAGCTGAGATTCGTGATCCAAAAAAGGCAGCAAGAGTGTGGCTAGGCACCTTCGACACTGCTGAGGCTGCAGCACTTGCTTACGATGAAGCTGCCCTTAGATTCAAAGGCACAAAAGCCAAGCTCAACTTCCCTGAGAGGCTCACCACTCCACCCTCCTATGCCTATCATCATCCCACCTTTATGCTCAATCTCCACTCCTCAACTTCTCATCCTTCCCATCATCAGGACCACAAAAACTAA MSAMVCALGEVIRSGSSKSPAVVEADYWPESESQSQRADHEEEVKRESRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEAAALAYDEAALRFKGTKAKLNFPERLTTPPSYAYHHPTFMLNLHSSTSHPSHHQDHKN
BLAST of Cla97C06G128180 vs. NCBI nr
Match: XP_008464362.1 (PREDICTED: ethylene-responsive transcription factor ERF115 [Cucumis melo] >ADN33855.1 AP2 domain transcription factor RAP2.3 [Cucumis melo subsp. melo]) HSP 1 Score: 166.8 bits (421), Expect = 5.4e-38 Identity = 93/138 (67.39%), Postives = 99/138 (71.74%), Query Frame = 0
BLAST of Cla97C06G128180 vs. NCBI nr
Match: XP_004138017.1 (PREDICTED: ethylene-responsive transcription factor ERF115 [Cucumis sativus]) HSP 1 Score: 165.6 bits (418), Expect = 1.2e-37 Identity = 93/136 (68.38%), Postives = 96/136 (70.59%), Query Frame = 0
BLAST of Cla97C06G128180 vs. NCBI nr
Match: XP_022921378.1 (ethylene-responsive transcription factor ERF114-like, partial [Cucurbita moschata]) HSP 1 Score: 165.2 bits (417), Expect = 1.6e-37 Identity = 92/119 (77.31%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of Cla97C06G128180 vs. NCBI nr
Match: KGN63431.1 (hypothetical protein Csa_1G000550 [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 2.1e-37 Identity = 94/138 (68.12%), Postives = 97/138 (70.29%), Query Frame = 0
BLAST of Cla97C06G128180 vs. NCBI nr
Match: XP_023516838.1 (ethylene-responsive transcription factor ERF115-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 156.0 bits (393), Expect = 9.6e-35 Identity = 86/118 (72.88%), Postives = 92/118 (77.97%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TrEMBL
Match: tr|A0A1S3CLA5|A0A1S3CLA5_CUCME (ethylene-responsive transcription factor ERF115 OS=Cucumis melo OX=3656 GN=LOC103502272 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 3.6e-38 Identity = 93/138 (67.39%), Postives = 99/138 (71.74%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TrEMBL
Match: tr|E5GBL4|E5GBL4_CUCME (AP2 domain transcription factor RAP2.3 OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 3.6e-38 Identity = 93/138 (67.39%), Postives = 99/138 (71.74%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TrEMBL
Match: tr|A0A0A0LTV8|A0A0A0LTV8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G000550 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 1.4e-37 Identity = 94/138 (68.12%), Postives = 97/138 (70.29%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TrEMBL
Match: tr|B9RG00|B9RG00_RICCO (AP2 domain transcription factor RAP2.3, putative OS=Ricinus communis OX=3988 GN=RCOM_1438370 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 2.8e-30 Identity = 79/130 (60.77%), Postives = 90/130 (69.23%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TrEMBL
Match: tr|A0A1L6CB18|A0A1L6CB18_9ROSI (AP2/ERF domain-containing transcription factor (Fragment) OS=Vernicia montana OX=316732 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 6.1e-30 Identity = 80/138 (57.97%), Postives = 95/138 (68.84%), Query Frame = 0
BLAST of Cla97C06G128180 vs. Swiss-Prot
Match: sp|Q9FH54|EF114_ARATH (Ethylene-responsive transcription factor ERF114 OS=Arabidopsis thaliana OX=3702 GN=ERF114 PE=1 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 8.3e-30 Identity = 72/126 (57.14%), Postives = 88/126 (69.84%), Query Frame = 0
BLAST of Cla97C06G128180 vs. Swiss-Prot
Match: sp|Q9LYU3|EF113_ARATH (Ethylene-responsive transcription factor ERF113 OS=Arabidopsis thaliana OX=3702 GN=ERF113 PE=2 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 2.2e-27 Identity = 69/110 (62.73%), Postives = 80/110 (72.73%), Query Frame = 0
BLAST of Cla97C06G128180 vs. Swiss-Prot
Match: sp|Q70II3|EF110_ARATH (Ethylene-responsive transcription factor ERF110 OS=Arabidopsis thaliana OX=3702 GN=ERF110 PE=2 SV=2) HSP 1 Score: 121.3 bits (303), Expect = 8.5e-27 Identity = 65/96 (67.71%), Postives = 74/96 (77.08%), Query Frame = 0
BLAST of Cla97C06G128180 vs. Swiss-Prot
Match: sp|Q9LY29|EF115_ARATH (Ethylene-responsive transcription factor ERF115 OS=Arabidopsis thaliana OX=3702 GN=ERF115 PE=1 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 3.2e-26 Identity = 66/110 (60.00%), Postives = 78/110 (70.91%), Query Frame = 0
BLAST of Cla97C06G128180 vs. Swiss-Prot
Match: sp|P93007|EF112_ARATH (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana OX=3702 GN=ERF112 PE=1 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 2.1e-25 Identity = 58/90 (64.44%), Postives = 66/90 (73.33%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TAIR10
Match: AT5G61890.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 131.3 bits (329), Expect = 4.6e-31 Identity = 72/126 (57.14%), Postives = 88/126 (69.84%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TAIR10
Match: AT5G13330.1 (related to AP2 6l) HSP 1 Score: 123.2 bits (308), Expect = 1.2e-28 Identity = 69/110 (62.73%), Postives = 80/110 (72.73%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TAIR10
Match: AT5G50080.1 (ethylene response factor 110) HSP 1 Score: 121.3 bits (303), Expect = 4.7e-28 Identity = 65/96 (67.71%), Postives = 74/96 (77.08%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TAIR10
Match: AT5G07310.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 119.4 bits (298), Expect = 1.8e-27 Identity = 66/110 (60.00%), Postives = 78/110 (70.91%), Query Frame = 0
BLAST of Cla97C06G128180 vs. TAIR10
Match: AT2G33710.2 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 116.7 bits (291), Expect = 1.2e-26 Identity = 58/90 (64.44%), Postives = 66/90 (73.33%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|