Bhi01G000622 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGAAACGGCGAAGTTGAACGCGGCGAGGTCCGGCTTGGTGGTTATCGGAGCTCTGGCCTTCGGATACCTGAGCCTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAGCTCAAAGTTCTCTTCAACATCCCGATTCCGAGCCCTCTACAATTCCAAAAGACGCTATTTCAAAACGCGATGATTAA ATGAAGGAAACGGCGAAGTTGAACGCGGCGAGGTCCGGCTTGGTGGTTATCGGAGCTCTGGCCTTCGGATACCTGAGCCTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAGCTCAAAGTTCTCTTCAACATCCCGATTCCGAGCCCTCTACAATTCCAAAAGACGCTATTTCAAAACGCGATGATTAA ATGAAGGAAACGGCGAAGTTGAACGCGGCGAGGTCCGGCTTGGTGGTTATCGGAGCTCTGGCCTTCGGATACCTGAGCCTACAGCTCGTGTTCAAGCCCTACCTCGAGAAAGCTCAAAGTTCTCTTCAACATCCCGATTCCGAGCCCTCTACAATTCCAAAAGACGCTATTTCAAAACGCGATGATTAA MKETAKLNAARSGLVVIGALAFGYLSLQLVFKPYLEKAQSSLQHPDSEPSTIPKDAISKRDD
BLAST of Bhi01G000622 vs. TAIR10
Match: AT5G19151.1 (unknown protein) HSP 1 Score: 52.4 bits (124), Expect = 1.2e-07 Identity = 25/39 (64.10%), Postives = 32/39 (82.05%), Query Frame = 0
BLAST of Bhi01G000622 vs. TAIR10
Match: AT3G63160.1 (FUNCTIONS IN: molecular_function unknown) HSP 1 Score: 42.7 bits (99), Expect = 9.4e-05 Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of Bhi01G000622 vs. TAIR10
Match: AT3G52420.1 (outer envelope membrane protein 7) HSP 1 Score: 40.4 bits (93), Expect = 4.6e-04 Identity = 19/50 (38.00%), Postives = 34/50 (68.00%), Query Frame = 0
BLAST of Bhi01G000622 vs. TrEMBL
Match: tr|A0A0A0L5N1|A0A0A0L5N1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G149930 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.7e-21 Identity = 57/61 (93.44%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Bhi01G000622 vs. TrEMBL
Match: tr|W9R337|W9R337_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_007349 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.9e-09 Identity = 31/51 (60.78%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of Bhi01G000622 vs. TrEMBL
Match: tr|A0A2I0L8Y5|A0A2I0L8Y5_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_002446 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 32/51 (62.75%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of Bhi01G000622 vs. TrEMBL
Match: tr|A0A2P5E3N7|A0A2P5E3N7_PARAD (Uncharacterized protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_006040 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.9e-07 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Bhi01G000622 vs. TrEMBL
Match: tr|A0A1U7Y866|A0A1U7Y866_NICSY (uncharacterized protein LOC104242143 OS=Nicotiana sylvestris OX=4096 GN=LOC104242143 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-07 Identity = 32/49 (65.31%), Postives = 41/49 (83.67%), Query Frame = 0
BLAST of Bhi01G000622 vs. NCBI nr
Match: KGN57013.1 (hypothetical protein Csa_3G149930 [Cucumis sativus]) HSP 1 Score: 110.2 bits (274), Expect = 2.6e-21 Identity = 57/61 (93.44%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Bhi01G000622 vs. NCBI nr
Match: EXB55018.1 (hypothetical protein L484_007349 [Morus notabilis]) HSP 1 Score: 67.8 bits (164), Expect = 1.5e-08 Identity = 31/51 (60.78%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of Bhi01G000622 vs. NCBI nr
Match: PKI77164.1 (hypothetical protein CRG98_002446 [Punica granatum]) HSP 1 Score: 64.3 bits (155), Expect = 1.7e-07 Identity = 32/51 (62.75%), Postives = 43/51 (84.31%), Query Frame = 0
BLAST of Bhi01G000622 vs. NCBI nr
Match: PON80154.1 (hypothetical protein PanWU01x14_006040 [Parasponia andersonii]) HSP 1 Score: 63.5 bits (153), Expect = 2.8e-07 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Bhi01G000622 vs. NCBI nr
Match: XP_009795444.1 (PREDICTED: uncharacterized protein LOC104242143 [Nicotiana sylvestris]) HSP 1 Score: 63.2 bits (152), Expect = 3.7e-07 Identity = 32/49 (65.31%), Postives = 41/49 (83.67%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |