![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmaCh00G001010 (gene) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTATGGAATTATGGAATCGAGCCTCTTCCTGGAGAAGAAAATCAATATATTGCTTATCTAGCTTATCCCCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTGACTTCCATTGTGGTTAATGTATGTGGATTCAAGGCTCTGCGTGCTCTACGTCTGTTTGCGAATCCCTACCGCTTATATTCAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGA ATGCTATGGAATTATGGAATCGAGCCTCTTCCTGGAGAAGAAAATCAATATATTGCTTATCTAGCTTATCCCCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTGACTTCCATTGTGGTTAATGCTCTGCGTGCTCTACGTCTGTTTGCGAATCCCTACCGCTTATATTCAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGA ATGCTATGGAATTATGGAATCGAGCCTCTTCCTGGAGAAGAAAATCAATATATTGCTTATCTAGCTTATCCCCTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTGACTTCCATTGTGGTTAATGCTCTGCGTGCTCTACGTCTGTTTGCGAATCCCTACCGCTTATATTCAAACTTTCCAAGGCCCGCCTCATGGTATCCAGGTTGA MLWNYGIEPLPGEENQYIAYLAYPLDLFEEGSVTNMLTSIVVNALRALRLFANPYRLYSNFPRPASWYPG Homology
BLAST of CmaCh00G001010 vs. ExPASy Swiss-Prot
Match: P36478 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Anthocleista grandiflora OX=28539 GN=rbcL PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-15 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy Swiss-Prot
Match: P48693 (Ribulose bisphosphate carboxylase large chain OS=Cichorium intybus OX=13427 GN=rbcL PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-15 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy Swiss-Prot
Match: P48697 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Cucurbita pepo OX=3663 GN=rbcL PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-15 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy Swiss-Prot
Match: P48706 (Ribulose bisphosphate carboxylase large chain OS=Lactuca sativa OX=4236 GN=rbcL PE=3 SV=2) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-15 Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy Swiss-Prot
Match: P24312 (Ribulose bisphosphate carboxylase large chain OS=Cyanophora paradoxa OX=2762 GN=rbcL PE=3 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 6.4e-15 Identity = 41/52 (78.85%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy TrEMBL
Match: A0A482K4K5 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Symphyotrichum ontarionis OX=1503869 GN=rbcL PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.7e-13 Identity = 45/66 (68.18%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy TrEMBL
Match: Q5EKM1 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Schlechtendalia luzulifolia OX=41633 GN=rbcL PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.8e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy TrEMBL
Match: A0A076L5Q3 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Schlechtendalia luzulifolia OX=41633 GN=rbcL PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.8e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy TrEMBL
Match: C4MXL5 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Schlechtendalia luzulifolia OX=41633 GN=rbcL PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.8e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. ExPASy TrEMBL
Match: A0A3P6DZ92 (Ribulose bisphosphate carboxylase large chain OS=Brassica campestris OX=3711 GN=BRASC58T46418Z PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 6.2e-13 Identity = 46/72 (63.89%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of CmaCh00G001010 vs. NCBI nr
Match: QBP45630.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Symphyotrichum ontarionis]) HSP 1 Score: 83.6 bits (205), Expect = 7.6e-13 Identity = 45/66 (68.18%), Postives = 49/66 (74.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. NCBI nr
Match: AAW78405.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Schlechtendalia luzulifolia]) HSP 1 Score: 83.2 bits (204), Expect = 9.9e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. NCBI nr
Match: ACJ02961.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Schlechtendalia luzulifolia]) HSP 1 Score: 83.2 bits (204), Expect = 9.9e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. NCBI nr
Match: AIJ03450.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Schlechtendalia luzulifolia]) HSP 1 Score: 83.2 bits (204), Expect = 9.9e-13 Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of CmaCh00G001010 vs. NCBI nr
Match: VDD24459.1 (unnamed protein product [Brassica rapa]) HSP 1 Score: 82.8 bits (203), Expect = 1.3e-12 Identity = 46/72 (63.89%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of CmaCh00G001010 vs. TAIR 10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases ) HSP 1 Score: 72.4 bits (176), Expect = 1.6e-13 Identity = 38/51 (74.51%), Postives = 41/51 (80.39%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|