Bhi02G001729 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGTTTGGGCTCTAGAAGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTTGGTACTACAATCATTGGAGGAACAATACCTAAACCTGAGGATACTCCAGAATCTTTTCGATTGCTCGTTCGAGAATTACGATCTTTGGCTTTGGAACTGAATCATTTCCTTGTATCTGAGAAGAACATCCAGATTAATAGGAAGGAAGCTTAA ATGGAGGTTTGGGCTCTAGAAGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTTGGTACTACAATCATTGGAGGAACAATACCTAAACCTGAGGATACTCCAGAATCTTTTCGATTGCTCGTTCGAGAATTACGATCTTTGGCTTTGGAACTGAATCATTTCCTTGTATCTGAGAAGAACATCCAGATTAATAGGAAGGAAGCTTAA ATGGAGGTTTGGGCTCTAGAAGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTTGGTACTACAATCATTGGAGGAACAATACCTAAACCTGAGGATACTCCAGAATCTTTTCGATTGCTCGTTCGAGAATTACGATCTTTGGCTTTGGAACTGAATCATTTCCTTGTATCTGAGAAGAACATCCAGATTAATAGGAAGGAAGCTTAA MEVWALEGFGVAHILQEMLTYKSDHIRARQEVLGTTIIGGTIPKPEDTPESFRLLVRELRSLALELNHFLVSEKNIQINRKEA Homology
BLAST of Bhi02G001729 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 162.2 bits (409), Expect = 1.8e-40 Identity = 80/82 (97.56%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy Swiss-Prot
Match: Q4VZP1 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 165.6 bits (418), Expect = 2.4e-40 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy Swiss-Prot
Match: A0ZZ27 (DNA-directed RNA polymerase subunit beta OS=Gossypium barbadense OX=3634 GN=rpoB PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 8.9e-40 Identity = 81/83 (97.59%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy Swiss-Prot
Match: Q2L8Z9 (DNA-directed RNA polymerase subunit beta OS=Gossypium hirsutum OX=3635 GN=rpoB PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 8.9e-40 Identity = 81/83 (97.59%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy Swiss-Prot
Match: A4QK10 (DNA-directed RNA polymerase subunit beta OS=Arabis hirsuta OX=78191 GN=rpoB PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 2.6e-39 Identity = 80/82 (97.56%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy Swiss-Prot
Match: P50546 (DNA-directed RNA polymerase subunit beta OS=Arabidopsis thaliana OX=3702 GN=rpoB PE=3 SV=4) HSP 1 Score: 162.2 bits (409), Expect = 2.6e-39 Identity = 80/82 (97.56%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of Bhi02G001729 vs. NCBI nr
Match: AHM89856.1 (RNA polymerase beta subunit [Lagenaria siceraria]) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-37 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. NCBI nr
Match: YP_009236272.1 (RNA polymerase beta subunit [Gynostemma pentaphyllum] >YP_009440149.1 RNA polymerase beta subunit [Gynostemma longipes] >AMF83983.1 RNA polymerase beta subunit [Gynostemma pentaphyllum] >ANI25177.1 RNA polymerase beta subunit [Gynostemma pentaphyllum] >ATG86892.1 RNA polymerase beta subunit [Gynostemma longipes]) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-37 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. NCBI nr
Match: YP_009752827.1 (RNA polymerase subunit beta [Baijiania yunnanensis] >QIT05899.1 RNA polymerase subunit beta [Baijiania yunnanensis]) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-37 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. NCBI nr
Match: QJR52948.1 (RNA polymerase beta subunit [Herpetospermum pedunculosum]) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-37 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. NCBI nr
Match: YP_009753697.1 (RNA polymerase subunit beta [Trichosanthes nervifolia] >QIT05308.1 RNA polymerase subunit beta [Trichosanthes nervifolia]) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-37 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy TrEMBL
Match: A0A218KG28 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus var. hardwickii OX=319220 GN=rpoB PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.7e-38 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy TrEMBL
Match: A0A1X9Q1B9 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.7e-38 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy TrEMBL
Match: A0A249RZI0 (DNA-directed RNA polymerase subunit beta OS=Cucumis melo var. cantalupensis OX=3658 GN=rpoB PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.7e-38 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy TrEMBL
Match: A0A1S4ETZ9 (DNA-directed RNA polymerase subunit beta OS=Cucumis melo OX=3656 GN=rpoB PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.7e-38 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Bhi02G001729 vs. ExPASy TrEMBL
Match: A0A109WXU0 (DNA-directed RNA polymerase subunit beta OS=Gynostemma pentaphyllum OX=182084 GN=rpoB PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 8.7e-38 Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|