MELO3C035505 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAGCGCTGTAGATGCTGCAGGAGATCCTATTCCTACATCGGCGGTGCTAATGTCCTCCTCAAAGCACATCGCGATTAAGTGTCGATCGGAGAATGTGGCATACCTCCAGTGCAAACAGAAGGATCCCAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCACTCGATGCGTCCTCTCCCTGTAA ATGGCGAGCGCTGTAGATGCTGCAGGAGATCCTATTCCTACATCGGCGGTGCTAATGTCCTCCTCAAAGCACATCGCGATTAAGTGTCGATCGGAGAATGTGGCATACCTCCAGTGCAAACAGAAGGATCCCAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCACTCGATGCGTCCTCTCCCTGTAA ATGGCGAGCGCTGTAGATGCTGCAGGAGATCCTATTCCTACATCGGCGGTGCTAATGTCCTCCTCAAAGCACATCGCGATTAAGTGTCGATCGGAGAATGTGGCATACCTCCAGTGCAAACAGAAGGATCCCAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCACTCGATGCGTCCTCTCCCTGTAA MASAVDAAGDPIPTSAVLMSSSKHIAIKCRSENVAYLQCKQKDPNPEKCLDKGHQVTRCVLSL Homology
BLAST of MELO3C035505 vs. ExPASy Swiss-Prot
Match: Q8LGE7 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B OS=Arabidopsis thaliana OX=3702 GN=At5g18800 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 45/63 (71.43%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy Swiss-Prot
Match: Q9SQT4 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-A OS=Arabidopsis thaliana OX=3702 GN=At3g06310 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.5e-18 Identity = 41/61 (67.21%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MELO3C035505 vs. NCBI nr
Match: XP_004135555.1 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B [Cucumis sativus] >XP_008445083.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B [Cucumis melo] >KGN65934.1 hypothetical protein Csa_023175 [Cucumis sativus]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C035505 vs. NCBI nr
Match: KAA0054071.1 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8-B-like [Cucumis melo var. makuwa] >TYJ96852.1 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8-B-like [Cucumis melo var. makuwa]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C035505 vs. NCBI nr
Match: XP_038906805.1 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B [Benincasa hispida]) HSP 1 Score: 123.2 bits (308), Expect = 7.7e-25 Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of MELO3C035505 vs. NCBI nr
Match: XP_038893587.1 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like [Benincasa hispida]) HSP 1 Score: 123.2 bits (308), Expect = 7.7e-25 Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 0
BLAST of MELO3C035505 vs. NCBI nr
Match: XP_022958837.1 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like [Cucurbita moschata] >XP_023006426.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like [Cucurbita maxima] >XP_023548394.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like [Cucurbita pepo subsp. pepo] >KAG7013612.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 119.8 bits (299), Expect = 8.6e-24 Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy TrEMBL
Match: A0A5A7UKJ4 (NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 8-B-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold10G00070 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.2e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy TrEMBL
Match: A0A0A0LY30 (CHCH domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G538810 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.2e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy TrEMBL
Match: A0A1S3BBD5 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B OS=Cucumis melo OX=3656 GN=LOC103488226 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.2e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy TrEMBL
Match: A0A6J1KXR2 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like OS=Cucurbita maxima OX=3661 GN=LOC111499155 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.1e-24 Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of MELO3C035505 vs. ExPASy TrEMBL
Match: A0A6J1H2X4 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B-like OS=Cucurbita moschata OX=3662 GN=LOC111459990 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.1e-24 Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of MELO3C035505 vs. TAIR 10
Match: AT5G18800.1 (Cox19-like CHCH family protein ) HSP 1 Score: 99.0 bits (245), Expect = 1.5e-21 Identity = 45/63 (71.43%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of MELO3C035505 vs. TAIR 10
Match: AT5G18800.2 (Cox19-like CHCH family protein ) HSP 1 Score: 99.0 bits (245), Expect = 1.5e-21 Identity = 45/63 (71.43%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of MELO3C035505 vs. TAIR 10
Match: AT3G06310.1 (Cox19-like CHCH family protein ) HSP 1 Score: 92.8 bits (229), Expect = 1.0e-19 Identity = 41/61 (67.21%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MELO3C035505 vs. TAIR 10
Match: AT3G06310.2 (Cox19-like CHCH family protein ) HSP 1 Score: 92.8 bits (229), Expect = 1.0e-19 Identity = 41/61 (67.21%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MELO3C035505 vs. TAIR 10
Match: AT3G06310.3 (Cox19-like CHCH family protein ) HSP 1 Score: 92.8 bits (229), Expect = 1.0e-19 Identity = 41/61 (67.21%), Postives = 51/61 (83.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|