HG10021395 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAACTTGAAATTGTTGGAGGAGATTAACAAGTCGGGAAGAGCTTACATGACACATGCGGTTATTGAAGGAATGTATGTGATTCGATTTTCCGTCGGTGGGACGATGACGGAGGAACGACATGTCGTCATGGCGTGGAAGCTTGTGCAGGAGTTGGCCGAGAAAATGATTTAA ATGAACTTGAAATTGTTGGAGGAGATTAACAAGTCGGGAAGAGCTTACATGACACATGCGGTTATTGAAGGAATGTATGTGATTCGATTTTCCGTCGGTGGGACGATGACGGAGGAACGACATGTCGTCATGGCGTGGAAGCTTGTGCAGGAGTTGGCCGAGAAAATGATTTAA ATGAACTTGAAATTGTTGGAGGAGATTAACAAGTCGGGAAGAGCTTACATGACACATGCGGTTATTGAAGGAATGTATGTGATTCGATTTTCCGTCGGTGGGACGATGACGGAGGAACGACATGTCGTCATGGCGTGGAAGCTTGTGCAGGAGTTGGCCGAGAAAATGATTTAA MNLKLLEEINKSGRAYMTHAVIEGMYVIRFSVGGTMTEERHVVMAWKLVQELAEKMI Homology
BLAST of HG10021395 vs. NCBI nr
Match: XP_004135536.1 (tyrosine/DOPA decarboxylase 1 [Cucumis sativus] >KGN65883.1 hypothetical protein Csa_023348 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 2.9e-18 Identity = 47/57 (82.46%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of HG10021395 vs. NCBI nr
Match: KAG6583868.1 (Tyrosine/DOPA decarboxylase 2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-17 Identity = 47/56 (83.93%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10021395 vs. NCBI nr
Match: KAG7019491.1 (Tyrosine/DOPA decarboxylase 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-17 Identity = 47/56 (83.93%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10021395 vs. NCBI nr
Match: XP_022927630.1 (tyrosine/DOPA decarboxylase 1-like [Cucurbita moschata]) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-17 Identity = 46/56 (82.14%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10021395 vs. NCBI nr
Match: XP_038894117.1 (tyrosine decarboxylase-like [Benincasa hispida]) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-17 Identity = 45/57 (78.95%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy Swiss-Prot
Match: O82415 (Tyrosine decarboxylase OS=Papaver somniferum OX=3469 GN=TYDC PE=1 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 4.4e-14 Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy Swiss-Prot
Match: P54771 (Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum OX=3469 GN=TYDC5 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 5.8e-14 Identity = 34/57 (59.65%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy Swiss-Prot
Match: P54768 (Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum OX=3469 GN=TYDC1 PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 7.6e-14 Identity = 34/57 (59.65%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy Swiss-Prot
Match: Q0ZS27 (Phenylacetaldehyde synthase OS=Rosa hybrid cultivar OX=128735 GN=PAAS PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.2e-13 Identity = 33/57 (57.89%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy Swiss-Prot
Match: P54769 (Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum OX=3469 GN=TYDC2 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.9e-12 Identity = 31/57 (54.39%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy TrEMBL
Match: A0A0A0LVR1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G537330 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.4e-18 Identity = 47/57 (82.46%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy TrEMBL
Match: A0A6J1EPI2 (tyrosine/DOPA decarboxylase 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434399 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.2e-17 Identity = 46/56 (82.14%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy TrEMBL
Match: A0A5A7UJZ1 (Tyrosine/DOPA decarboxylase 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold10G00540 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 5.8e-17 Identity = 43/56 (76.79%), Postives = 53/56 (94.64%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy TrEMBL
Match: A0A1S3BAL4 (LOW QUALITY PROTEIN: tyrosine/DOPA decarboxylase 2-like OS=Cucumis melo OX=3656 GN=LOC103487999 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 5.8e-17 Identity = 43/56 (76.79%), Postives = 53/56 (94.64%), Query Frame = 0
BLAST of HG10021395 vs. ExPASy TrEMBL
Match: A0A6J1KL51 (tyrosine/DOPA decarboxylase 1-like OS=Cucurbita maxima OX=3661 GN=LOC111495556 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 9.9e-17 Identity = 44/56 (78.57%), Postives = 52/56 (92.86%), Query Frame = 0
BLAST of HG10021395 vs. TAIR 10
Match: AT4G28680.1 (L-tyrosine decarboxylase ) HSP 1 Score: 58.2 bits (139), Expect = 2.6e-09 Identity = 22/54 (40.74%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of HG10021395 vs. TAIR 10
Match: AT4G28680.2 (L-tyrosine decarboxylase ) HSP 1 Score: 58.2 bits (139), Expect = 2.6e-09 Identity = 22/54 (40.74%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of HG10021395 vs. TAIR 10
Match: AT4G28680.3 (L-tyrosine decarboxylase ) HSP 1 Score: 58.2 bits (139), Expect = 2.6e-09 Identity = 22/54 (40.74%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of HG10021395 vs. TAIR 10
Match: AT4G28680.4 (L-tyrosine decarboxylase ) HSP 1 Score: 58.2 bits (139), Expect = 2.6e-09 Identity = 22/54 (40.74%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of HG10021395 vs. TAIR 10
Match: AT2G20340.1 (Pyridoxal phosphate (PLP)-dependent transferases superfamily protein ) HSP 1 Score: 57.8 bits (138), Expect = 3.4e-09 Identity = 23/56 (41.07%), Postives = 39/56 (69.64%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|