CaUC01G010650 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TTCAAACTTGATCACAATGGCTAGATCTCTTTTTTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCGACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGAAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAGTTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTAATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAAGCTTTCTTTTGCTTCTCATCAATAACTATGT TTCAAACTTGATCACAATGGCTAGATCTCTTTTTTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCGACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGAAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAGTTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTAATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAAGCTTTCTTTTGCTTCTCATCAATAACTATGT ATGGCTAGATCTCTTTTTTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCGACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGAAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAGTTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTAATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA MARSLFFIVSLLLFVSMLSVTATRSRLDLVGGYEPIKSIDDPHIQSLEEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYDLRLMALEGTVSRTYGTLVFTNLKNENHLINFYGLSN Homology
BLAST of CaUC01G010650 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 188.0 bits (476), Expect = 4.8e-44 Identity = 99/119 (83.19%), Postives = 110/119 (92.44%), Query Frame = 0
BLAST of CaUC01G010650 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 1.4e-40 Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of CaUC01G010650 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 1.4e-40 Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of CaUC01G010650 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 173.3 bits (438), Expect = 1.2e-39 Identity = 91/114 (79.82%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of CaUC01G010650 vs. NCBI nr
Match: TYK30896.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 169.9 bits (429), Expect = 1.4e-38 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 2.3e-12 Identity = 42/102 (41.18%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 5.0e-12 Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 70.1 bits (170), Expect = 1.9e-11 Identity = 36/94 (38.30%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 8.0e-10 Identity = 29/79 (36.71%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-09 Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 7.0e-41 Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.5e-39 Identity = 88/112 (78.57%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 2.1e-37 Identity = 86/119 (72.27%), Postives = 103/119 (86.55%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy TrEMBL
Match: A0A5A7T201 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold285G003390 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 2.1e-37 Identity = 81/102 (79.41%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of CaUC01G010650 vs. ExPASy TrEMBL
Match: A0A6J1IC30 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111471626 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 2.3e-36 Identity = 84/118 (71.19%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of CaUC01G010650 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.6e-13 Identity = 42/102 (41.18%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of CaUC01G010650 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 5.7e-11 Identity = 29/79 (36.71%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of CaUC01G010650 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 52.4 bits (124), Expect = 2.9e-07 Identity = 39/106 (36.79%), Postives = 57/106 (53.77%), Query Frame = 0
BLAST of CaUC01G010650 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 52.0 bits (123), Expect = 3.8e-07 Identity = 35/107 (32.71%), Postives = 57/107 (53.27%), Query Frame = 0
BLAST of CaUC01G010650 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 51.2 bits (121), Expect = 6.5e-07 Identity = 29/90 (32.22%), Postives = 49/90 (54.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|