CcUC06G119760 (gene) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGGGAGGTCCGTTTGATATCCAAAAATTGCTCAGCAACAGTCGGACAAGTGGGGAATGCTGGGGTAAACCAGAAAAGTTTGGGTAGAGCCGGATCTAAATGTTGGCTAGGTAAGCGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGTTATCCTGCACTTGGAAGAAGAAGTCGAAAAAGGAATAAATATAGTGATAATTTGATTCTTCGTCGCCGTAGTAAATAA ATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGGGAGGTCCGTTTGATATCCAAAAATTGCTCAGCAACAGTCGGACAAGTGGGGAATGCTGGGGTAAACCAGAAAAGTTTGGGTAGAGCCGGATCTAAATGTTGGCTAGGTAAGCGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGTTATCCTGCACTTGGAAGAAGAAGTCGAAAAAGGAATAAATATAGTGATAATTTGATTCTTCGTCGCCGTAGTAAATAA ATGCCCTTAGGCACGGCCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTAAAATTACCTTCTGGGGAGGTCCGTTTGATATCCAAAAATTGCTCAGCAACAGTCGGACAAGTGGGGAATGCTGGGGTAAACCAGAAAAGTTTGGGTAGAGCCGGATCTAAATGTTGGCTAGGTAAGCGTCCTGTAGTAAGAGGAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGGAGGGCCCCAATTGGTAGAAAAAAACCCGCAACCCCTTGGGGTTATCCTGCACTTGGAAGAAGAAGTCGAAAAAGGAATAAATATAGTGATAATTTGATTCTTCGTCGCCGTAGTAAATAA MPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNAGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRSK Homology
BLAST of CcUC06G119760 vs. NCBI nr
Match: YP_010119775.1 (ribosomal protein L2 [Hemsleya zhejiangensis] >YP_010119798.1 ribosomal protein L2 [Hemsleya zhejiangensis] >QRC26944.1 ribosomal protein L2 [Hemsleya zhejiangensis] >QRC26945.1 ribosomal protein L2 [Hemsleya zhejiangensis]) HSP 1 Score: 281.2 bits (718), Expect = 5.0e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. NCBI nr
Match: WP_131792711.1 (50S ribosomal protein L2 [Candidatus Frankia datiscae]) HSP 1 Score: 281.2 bits (718), Expect = 5.0e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. NCBI nr
Match: QCY72905.1 (ribosomal protein L2 [Cucumis hystrix]) HSP 1 Score: 281.2 bits (718), Expect = 5.0e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. NCBI nr
Match: YP_009687060.1 (ribosomal protein L2 [Klainedoxa gabonensis] >YP_009687081.1 ribosomal protein L2 [Klainedoxa gabonensis] >QDW75806.1 ribosomal protein L2 [Klainedoxa gabonensis] >QDW75829.1 ribosomal protein L2 [Klainedoxa gabonensis]) HSP 1 Score: 281.2 bits (718), Expect = 5.0e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. NCBI nr
Match: YP_004841825.1 (ribosomal protein L2 [Cucumis melo subsp. melo] >YP_009317427.1 ribosomal protein L2 [Coccinia grandis] >YP_009317449.1 ribosomal protein L2 [Coccinia grandis] >YP_009346539.1 ribosomal protein L2 [Cucumis x hytivus] >YP_009525227.1 ribosomal protein L2 [Hodgsonia macrocarpa] >YP_009525248.1 ribosomal protein L2 [Hodgsonia macrocarpa] >YP_009751526.1 ribosomal protein L2 [Thladiantha dubia] >YP_009751548.1 ribosomal protein L2 [Thladiantha dubia] >YP_009751694.1 ribosomal protein L2 [Hodgsonia heteroclita] >YP_009751716.1 ribosomal protein L2 [Hodgsonia heteroclita] >YP_009751863.1 ribosomal protein L2 [Indofevillea khasiana] >YP_009751884.1 ribosomal protein L2 [Indofevillea khasiana] >YP_009751947.1 ribosomal protein L2 [Cyclanthera pedata] >YP_009751968.1 ribosomal protein L2 [Cyclanthera pedata] >YP_009752031.1 ribosomal protein L2 [Cionosicys macranthus] >YP_009752053.1 ribosomal protein L2 [Cionosicys macranthus] >YP_009752284.1 ribosomal protein L2 [Trichosanthes baviensis] >YP_009752305.1 ribosomal protein L2 [Trichosanthes baviensis] >YP_009752453.1 ribosomal protein L2 [Trichosanthes tricuspidata] >YP_009752474.1 ribosomal protein L2 [Trichosanthes tricuspidata] >YP_009752537.1 ribosomal protein L2 [Trichosanthes tubiflora] >YP_009752559.1 ribosomal protein L2 [Trichosanthes tubiflora] >YP_009752622.1 ribosomal protein L2 [Trichosanthes homophylla] >YP_009752644.1 ribosomal protein L2 [Trichosanthes homophylla] >YP_009752876.1 ribosomal protein L2 [Baijiania yunnanensis] >YP_009752898.1 ribosomal protein L2 [Baijiania yunnanensis] >YP_009752961.1 ribosomal protein L2 [Momordica sessilifolia] >YP_009752982.1 ribosomal protein L2 [Momordica sessilifolia] >YP_009753045.1 ribosomal protein L2 [Gerrardanthus macrorhizus] >YP_009753067.1 ribosomal protein L2 [Gerrardanthus macrorhizus] >YP_009753130.1 ribosomal protein L2 [Corallocarpus boehmii] >YP_009753152.1 ribosomal protein L2 [Corallocarpus boehmii] >YP_009753215.1 ribosomal protein L2 [Trichosanthes truncata] >YP_009753236.1 ribosomal protein L2 [Trichosanthes truncata] >YP_009753298.1 ribosomal protein L2 [Nothoalsomitra suberosa] >YP_009753320.1 ribosomal protein L2 [Nothoalsomitra suberosa] >YP_009753661.1 ribosomal protein L2 [Trichosanthes wallichiana] >YP_009753683.1 ribosomal protein L2 [Trichosanthes wallichiana] >YP_009753746.1 ribosomal protein L2 [Trichosanthes nervifolia] >YP_009753767.1 ribosomal protein L2 [Trichosanthes nervifolia] >YP_009753830.1 ribosomal protein L2 [Trichosanthes pilosa] >YP_009753852.1 ribosomal protein L2 [Trichosanthes pilosa] >YP_009753915.1 ribosomal protein L2 [Trichosanthes lobata] >YP_009753937.1 ribosomal protein L2 [Trichosanthes lobata] >YP_009860115.1 ribosomal protein L2 [Cucumis melo subsp. agrestis] >YP_009860139.1 ribosomal protein L2 [Cucumis melo subsp. agrestis] >YP_010131135.1 ribosomal protein L2 [Benincasa hispida] >YP_010131156.1 ribosomal protein L2 [Benincasa hispida] >YP_247641.1 ribosomal protein L2 [Cucumis sativus] >YP_247663.1 ribosomal protein L2 [Cucumis sativus] >Q4VZK5.1 RecName: Full=50S ribosomal protein L2, chloroplastic [Cucumis sativus] >ALF03343.1 ribosomal protein L2 [Cucumis sativus var. hardwickii] >AXU40582.1 ribosomal protein L2 [Gomphogyne cissiformis var. cissiformis] >QIT04091.1 ribosomal protein L2 [Luffa aegyptiaca] >QIT04174.1 ribosomal protein L2 [Sechium edule] >QIT05103.1 ribosomal protein L2 [Trichosanthes kirilowii] >QKX48516.1 ribosomal protein L2 [Luffa acutangula] >QZL38635.1 ribosomal protein L2 [Citrullus naudinianus] >QZL38723.1 ribosomal protein L2 [Citrullus ecirrhosus]) HSP 1 Score: 281.2 bits (718), Expect = 5.0e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy Swiss-Prot
Match: Q4VZK5 (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 6.6e-75 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy Swiss-Prot
Match: Q14F95 (50S ribosomal protein L2-A, chloroplastic OS=Populus alba OX=43335 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 280.0 bits (715), Expect = 1.5e-74 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy Swiss-Prot
Match: Q14FB6 (50S ribosomal protein L2-B, chloroplastic OS=Populus alba OX=43335 GN=rpl2-B PE=3 SV=1) HSP 1 Score: 280.0 bits (715), Expect = 1.5e-74 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy Swiss-Prot
Match: A4GYV2 (50S ribosomal protein L2, chloroplastic OS=Populus trichocarpa OX=3694 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 280.0 bits (715), Expect = 1.5e-74 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy Swiss-Prot
Match: B1A976 (50S ribosomal protein L2, chloroplastic OS=Carica papaya OX=3649 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 279.6 bits (714), Expect = 1.9e-74 Identity = 141/142 (99.30%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy TrEMBL
Match: A0A218KG93 (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rpl2 PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 2.4e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy TrEMBL
Match: A0A7G8QE64 (Ribosomal protein L2 OS=Balanops balansae OX=544656 GN=rpl2 PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 2.4e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy TrEMBL
Match: A0A5B8GX79 (Ribosomal protein L2 OS=Klainedoxa gabonensis OX=289639 GN=rpl2 PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 2.4e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy TrEMBL
Match: A0A218KG69 (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rpl2 PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 2.4e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. ExPASy TrEMBL
Match: A0A6H0ET23 (50S ribosomal protein L2, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=rpl2 PE=3 SV=1) HSP 1 Score: 281.2 bits (718), Expect = 2.4e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of CcUC06G119760 vs. TAIR 10
Match: ATCG00830.1 (ribosomal protein L2 ) HSP 1 Score: 269.6 bits (688), Expect = 1.4e-72 Identity = 135/142 (95.07%), Postives = 138/142 (97.18%), Query Frame = 0
BLAST of CcUC06G119760 vs. TAIR 10
Match: ATCG01310.1 (ribosomal protein L2 ) HSP 1 Score: 269.6 bits (688), Expect = 1.4e-72 Identity = 135/142 (95.07%), Postives = 138/142 (97.18%), Query Frame = 0
BLAST of CcUC06G119760 vs. TAIR 10
Match: AT2G44065.1 (Ribosomal protein L2 family ) HSP 1 Score: 115.2 bits (287), Expect = 4.4e-26 Identity = 61/126 (48.41%), Postives = 77/126 (61.11%), Query Frame = 0
BLAST of CcUC06G119760 vs. TAIR 10
Match: AT2G44065.2 (Ribosomal protein L2 family ) HSP 1 Score: 115.2 bits (287), Expect = 4.4e-26 Identity = 61/126 (48.41%), Postives = 77/126 (61.11%), Query Frame = 0
BLAST of CcUC06G119760 vs. TAIR 10
Match: AT3G51190.1 (Ribosomal protein L2 family ) HSP 1 Score: 82.0 bits (201), Expect = 4.2e-16 Identity = 59/145 (40.69%), Postives = 76/145 (52.41%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|