![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi02G011160 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCCTTCTCCTCTTCGTTGTATCACTGTCGTCGGTCGCAGCAACAAGGACACGGTTAGATTTGGTAGGTGGCTACGAACCAATAAAAAACATAGCTGATCCACACATCCAAAGCCTAGGAGAATTTGCAGTGAATGAACATAATAAACAAGCCAAAACTCAACTGAAATTTGAAAAAGTGATTGGTGGAAAATTACAGATTGTGGCTGGAACCAACTACGACCTTCAATTAACAGCTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAACAAGAATCACCTTATCAACTTCTATGGCATCTCCAACTAA ATGGCTTCCCTTCTCCTCTTCGTTGTATCACTGTCGTCGGTCGCAGCAACAAGGACACGGTTAGATTTGGTAGGTGGCTACGAACCAATAAAAAACATAGCTGATCCACACATCCAAAGCCTAGGAGAATTTGCAGTGAATGAACATAATAAACAAGCCAAAACTCAACTGAAATTTGAAAAAGTGATTGGTGGAAAATTACAGATTGTGGCTGGAACCAACTACGACCTTCAATTAACAGCTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAACAAGAATCACCTTATCAACTTCTATGGCATCTCCAACTAA ATGGCTTCCCTTCTCCTCTTCGTTGTATCACTGTCGTCGGTCGCAGCAACAAGGACACGGTTAGATTTGGTAGGTGGCTACGAACCAATAAAAAACATAGCTGATCCACACATCCAAAGCCTAGGAGAATTTGCAGTGAATGAACATAATAAACAAGCCAAAACTCAACTGAAATTTGAAAAAGTGATTGGTGGAAAATTACAGATTGTGGCTGGAACCAACTACGACCTTCAATTAACAGCTCTTGAAGGGAGTGTAAGCAGAACCTATGGGACCCTTGTATTCACTGATCTGAAGAACAAGAATCACCTTATCAACTTCTATGGCATCTCCAACTAA MASLLLFVVSLSSVAATRTRLDLVGGYEPIKNIADPHIQSLGEFAVNEHNKQAKTQLKFEKVIGGKLQIVAGTNYDLQLTALEGSVSRTYGTLVFTDLKNKNHLINFYGISN Homology
BLAST of Lsi02G011160 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 3.0e-14 Identity = 41/96 (42.71%), Postives = 67/96 (69.79%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 75.5 bits (184), Expect = 4.3e-13 Identity = 36/95 (37.89%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.3e-13 Identity = 38/94 (40.43%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.7e-12 Identity = 41/98 (41.84%), Postives = 61/98 (62.24%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 6.9e-11 Identity = 27/61 (44.26%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 1.3e-44 Identity = 94/112 (83.93%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.2e-43 Identity = 91/112 (81.25%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy TrEMBL
Match: A0A5A7T201 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold285G003390 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.2e-39 Identity = 81/102 (79.41%), Postives = 95/102 (93.14%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 8.1e-39 Identity = 85/112 (75.89%), Postives = 100/112 (89.29%), Query Frame = 0
BLAST of Lsi02G011160 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 8.1e-39 Identity = 86/111 (77.48%), Postives = 97/111 (87.39%), Query Frame = 0
BLAST of Lsi02G011160 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 193.4 bits (490), Expect = 1.1e-45 Identity = 97/112 (86.61%), Postives = 106/112 (94.64%), Query Frame = 0
BLAST of Lsi02G011160 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 188.7 bits (478), Expect = 2.7e-44 Identity = 94/112 (83.93%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Lsi02G011160 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 188.7 bits (478), Expect = 2.7e-44 Identity = 94/112 (83.93%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Lsi02G011160 vs. NCBI nr
Match: TYK30896.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 184.1 bits (466), Expect = 6.6e-43 Identity = 91/112 (81.25%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of Lsi02G011160 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 180.3 bits (456), Expect = 9.5e-42 Identity = 91/107 (85.05%), Postives = 100/107 (93.46%), Query Frame = 0
BLAST of Lsi02G011160 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-15 Identity = 41/96 (42.71%), Postives = 67/96 (69.79%), Query Frame = 0
BLAST of Lsi02G011160 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 68.2 bits (165), Expect = 4.9e-12 Identity = 27/61 (44.26%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of Lsi02G011160 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 56.6 bits (135), Expect = 1.5e-08 Identity = 31/90 (34.44%), Postives = 49/90 (54.44%), Query Frame = 0
BLAST of Lsi02G011160 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 54.7 bits (130), Expect = 5.6e-08 Identity = 36/96 (37.50%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of Lsi02G011160 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 52.8 bits (125), Expect = 2.1e-07 Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|