
Lcy08g000020 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAATGTTCAACTTTTGATGACCGTAGATGTTGATGGAGGCGTTTGTGCAAGTTTCCCGGTAAGTTTCCGTGCAAGTCAATTGAAAAATTAAAAGAAAATTGTAATTAACATTTGCATACTGTTTTCTGTTCATTCCCTTTAATATCAAAGGCAAGTCCACGCATCTGCTTTAACAAGGATTGGGCCCTTTTTGCTGTTTCTAGCAATGAGAATGGAATTAAAATCTTAGCAAATGTGGATGGAATCCAGCTATTGCAAGCATTTGAAAATCTTTCTTATGATGCATCTAGAACGTCAGAGGCCGGGATAAAGGTAGTTTGATTCTATGTTCAATTAATGTGACTTTTAACCATGTTAACTCTTTTGCTTAATATCTAATTAACTTATATTTAATTTTTGCAGCCCATAGTAAATCCAATTTCAACTGCTATTGGTAGTGTAGGCCTTGCTGAGAGAGCATAA ATGGACAATGTTCAACTTTTGATGACCGTAGATGTTGATGGAGGCGTTTGTGCAAGTTTCCCGGCAAGTCCACGCATCTGCTTTAACAAGGATTGGGCCCTTTTTGCTGTTTCTAGCAATGAGAATGGAATTAAAATCTTAGCAAATGTGGATGGAATCCAGCTATTGCAAGCATTTGAAAATCTTTCTTATGATGCATCTAGAACGTCAGAGGCCGGGATAAAGCCCATAGTAAATCCAATTTCAACTGCTATTGGTAGTGTAGGCCTTGCTGAGAGAGCATAA ATGGACAATGTTCAACTTTTGATGACCGTAGATGTTGATGGAGGCGTTTGTGCAAGTTTCCCGGCAAGTCCACGCATCTGCTTTAACAAGGATTGGGCCCTTTTTGCTGTTTCTAGCAATGAGAATGGAATTAAAATCTTAGCAAATGTGGATGGAATCCAGCTATTGCAAGCATTTGAAAATCTTTCTTATGATGCATCTAGAACGTCAGAGGCCGGGATAAAGCCCATAGTAAATCCAATTTCAACTGCTATTGGTAGTGTAGGCCTTGCTGAGAGAGCATAA MDNVQLLMTVDVDGGVCASFPASPRICFNKDWALFAVSSNENGIKILANVDGIQLLQAFENLSYDASRTSEAGIKPIVNPISTAIGSVGLAERA Homology
BLAST of Lcy08g000020 vs. ExPASy Swiss-Prot
Match: Q10NY2 (Protein TPR3 OS=Oryza sativa subsp. japonica OX=39947 GN=TPR3 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.1e-20 Identity = 51/95 (53.68%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy Swiss-Prot
Match: Q94AI7 (Protein TOPLESS OS=Arabidopsis thaliana OX=3702 GN=TPL PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.5e-14 Identity = 47/94 (50.00%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy Swiss-Prot
Match: Q0J7U6 (Protein TOPLESS-RELATED PROTEIN 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TPR2 PE=1 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.5e-14 Identity = 44/90 (48.89%), Postives = 59/90 (65.56%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy Swiss-Prot
Match: Q0WV90 (Topless-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPR1 PE=1 SV=3) HSP 1 Score: 76.6 bits (187), Expect = 1.6e-13 Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy Swiss-Prot
Match: Q9LRZ0 (Topless-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=TPR2 PE=1 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 40/91 (43.96%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy TrEMBL
Match: A0A2P5BSC8 (Topless-like WD40 repeat containing protein OS=Parasponia andersonii OX=3476 GN=PanTPL PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.0e-26 Identity = 66/94 (70.21%), Postives = 76/94 (80.85%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy TrEMBL
Match: A0A6J1DKI7 (protein TOPLESS OS=Momordica charantia OX=3673 GN=LOC111020907 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 8.6e-26 Identity = 69/101 (68.32%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy TrEMBL
Match: A0A6J1IYH0 (protein TOPLESS OS=Cucurbita maxima OX=3661 GN=LOC111479634 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 1.5e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy TrEMBL
Match: A0A6J1GUK9 (protein TOPLESS OS=Cucurbita moschata OX=3662 GN=LOC111457623 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 1.5e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. ExPASy TrEMBL
Match: A0A6J1KEV5 (protein TOPLESS-like OS=Cucurbita maxima OX=3661 GN=LOC111492626 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 2.5e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. NCBI nr
Match: PON51665.1 (Topless-like WD40 repeat containing protein [Parasponia andersonii]) HSP 1 Score: 127.5 bits (319), Expect = 6.1e-26 Identity = 66/94 (70.21%), Postives = 76/94 (80.85%), Query Frame = 0
BLAST of Lcy08g000020 vs. NCBI nr
Match: XP_022153396.1 (protein TOPLESS [Momordica charantia]) HSP 1 Score: 125.9 bits (315), Expect = 1.8e-25 Identity = 69/101 (68.32%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Lcy08g000020 vs. NCBI nr
Match: XP_023526905.1 (protein TPR3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 125.2 bits (313), Expect = 3.0e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. NCBI nr
Match: KAG7018371.1 (Protein TOPLESS [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 125.2 bits (313), Expect = 3.0e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. NCBI nr
Match: XP_022955701.1 (protein TOPLESS [Cucurbita moschata]) HSP 1 Score: 125.2 bits (313), Expect = 3.0e-25 Identity = 64/84 (76.19%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of Lcy08g000020 vs. TAIR 10
Match: AT1G15750.1 (Transducin family protein / WD-40 repeat family protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 47/94 (50.00%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Lcy08g000020 vs. TAIR 10
Match: AT1G15750.2 (Transducin family protein / WD-40 repeat family protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 47/94 (50.00%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Lcy08g000020 vs. TAIR 10
Match: AT1G15750.3 (Transducin family protein / WD-40 repeat family protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 47/94 (50.00%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Lcy08g000020 vs. TAIR 10
Match: AT1G15750.4 (Transducin family protein / WD-40 repeat family protein ) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 47/94 (50.00%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of Lcy08g000020 vs. TAIR 10
Match: AT1G80490.1 (TOPLESS-related 1 ) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-14 Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|