IVF0023799 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAGAAGGTGCAAAATCAATAGGAGCCGGAGCTGCTACAATTGCTTCAGCGGGAGTTGCTGTCAGTATTGGAAACGTCTTCAATTCTTTAATCCATTTCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTTTAACTGAAGCTACTGCATTGTTGCTCTAA ATGTTAGAAGGTGCAAAATCAATAGGAGCCGGAGCTGCTACAATTGCTTCAGCGGGAGTTGCTGTCAGTATTGGAAACGTCTTCAATTCTTTAATCCATTTCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTTTAACTGAAGCTACTGCATTGTTGCTCTAA ATGTTAGAAGGTGCAAAATCAATAGGAGCCGGAGCTGCTACAATTGCTTCAGCGGGAGTTGCTGTCAGTATTGGAAACGTCTTCAATTCTTTAATCCATTTCGTGGCGCGAAATCCATCATTGGCTAAACAATCATTTGGTTATGCAATTTTGGGCTTTGCTTTAACTGAAGCTACTGCATTGTTGCTCTAA MLEGAKSIGAGAATIASAGVAVSIGNVFNSLIHFVARNPSLAKQSFGYAILGFALTEATALLL Homology
BLAST of IVF0023799 vs. ExPASy Swiss-Prot
Match: P60113 (ATP synthase subunit 9, mitochondrial OS=Brassica napus OX=3708 GN=ATP9 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 5.4e-21 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy Swiss-Prot
Match: Q37550 (ATP synthase subunit 9, mitochondrial OS=Malus domestica OX=3750 GN=ATP9 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.2e-20 Identity = 54/60 (90.00%), Postives = 56/60 (93.33%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy Swiss-Prot
Match: P69420 (ATP synthase subunit 9, mitochondrial OS=Pisum sativum OX=3888 GN=ATP9 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy Swiss-Prot
Match: P69421 (ATP synthase subunit 9, mitochondrial OS=Glycine max OX=3847 GN=ATP9 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy Swiss-Prot
Match: P69422 (ATP synthase subunit 9, mitochondrial OS=Vicia faba OX=3906 GN=ATP9 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-20 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy TrEMBL
Match: A0A160DQR7 (ATP synthase subunit 9, mitochondrial OS=Allium cepa OX=4679 GN=atp9 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy TrEMBL
Match: A0A7G6KLQ4 (ATP synthase subunit 9, mitochondrial OS=Brassica juncea OX=3707 GN=atp9 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy TrEMBL
Match: J7MD23 (ATP synthase subunit 9, mitochondrial OS=Raphanus sativus OX=3726 GN=atp9 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy TrEMBL
Match: A0A5N6L1B2 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_025327 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. ExPASy TrEMBL
Match: A0A650GB85 (ATP-synt_C domain-containing protein OS=Raphanus sativus OX=3726 GN=orf273a PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. NCBI nr
Match: CBI19991.3 (unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 102 bits (255), Expect = 6.33e-27 Identity = 54/60 (90.00%), Postives = 57/60 (95.00%), Query Frame = 0
BLAST of IVF0023799 vs. NCBI nr
Match: YP_006665983.1 (ATP synthase subunit 9 [Raphanus sativus] >YP_006665994.1 ATP synthase subunit 9 [Raphanus sativus] >QNC68170.1 Atp9 [Brassica juncea] >AGC81716.1 ATPase subunit 9 [Raphanus sativus] >QGW48326.1 ATP synthase subunit 9 [Raphanus sativus] >QNC68187.1 Atp9 [Brassica juncea] >BAM36225.1 ATP synthase subunit 9 [Raphanus sativus]) HSP 1 Score: 102 bits (254), Expect = 8.06e-27 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. NCBI nr
Match: WP_131747030.1 (ATP synthase subunit C family protein [Candidatus Frankia meridionalis]) HSP 1 Score: 102 bits (254), Expect = 8.06e-27 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. NCBI nr
Match: BBD20369.1 (ATP synthase subunit 9 [Allium cepa]) HSP 1 Score: 102 bits (254), Expect = 1.09e-26 Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. NCBI nr
Match: BAA02855.2 (F0-ATPase subunit 9 [Brassica napus]) HSP 1 Score: 102 bits (253), Expect = 1.14e-26 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. TAIR 10
Match: AT2G07671.1 (ATP synthase subunit C family protein ) HSP 1 Score: 100.9 bits (250), Expect = 3.8e-22 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. TAIR 10
Match: ATMG01080.1 (mitochondrial F0-ATPase subunit 9 ) HSP 1 Score: 100.9 bits (250), Expect = 3.8e-22 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of IVF0023799 vs. TAIR 10
Match: ATMG00040.1 (ATP synthase subunit C family protein ) HSP 1 Score: 68.9 bits (167), Expect = 1.6e-12 Identity = 37/42 (88.10%), Postives = 39/42 (92.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|