IVF0004461 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACCGCAGTTGCTGTAACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAACGGCTGCCCAATCGAGCTCGTCGAACCTGAGATCTTACGCTTCAAGGCCTACGAACCCATCCTCCTTCTCGGCCGACACCGCTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCACAGATCTACGCTATCCGCCAGAGCATCGCTAAGGCTCTCGTTGCCTTTTACCAGAAGTACGTCGACGAACAGAGCAGAAGGAGATAAAGGACATTCTCGTTCGCTACGATCGGACTTTGCTCGTCGCTGATCCTAGACGCTGTGAGCCGAAGAAGTTTGGTGGTCGTGGAGCTCGTGCTAGATTCCAGAAATCATATCGTTGA ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACCGCAGTTGCTGTAACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAACGGCTGCCCAATCGAGCTCGTCGAACCTGAGATCTTACGCTTCAAGGCCTACGAACCCATCCTCCTTCTCGGCCGACACCGCTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCACAGATCTACGCTATCCGCCAGAGCATCGCTAAGGCTCTCGTTGCCTTTTACCAGAAGTACGACATTCTCGTTCGCTACGATCGGACTTTGCTCGTCGCTGATCCTAGACGCTGTGAGCCGAAGAAGTTTGGTGGTCGTGGAGCTCGTGCTAGATTCCAGAAATCATATCGTTGA ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACCGCAGTTGCTGTAACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAACGGCTGCCCAATCGAGCTCGTCGAACCTGAGATCTTACGCTTCAAGGCCTACGAACCCATCCTCCTTCTCGGCCGACACCGCTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCACAGATCTACGCTATCCGCCAGAGCATCGCTAAGGCTCTCGTTGCCTTTTACCAGAAGTACGACATTCTCGTTCGCTACGATCGGACTTTGCTCGTCGCTGATCCTAGACGCTGTGAGCCGAAGAAGTTTGGTGGTCGTGGAGCTCGTGCTAGATTCCAGAAATCATATCGTTGA MAAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR Homology
BLAST of IVF0004461 vs. ExPASy Swiss-Prot
Match: P46293 (40S ribosomal protein S16 OS=Gossypium hirsutum OX=3635 GN=RPS16 PE=2 SV=1) HSP 1 Score: 245.7 bits (626), Expect = 2.9e-64 Identity = 125/140 (89.29%), Postives = 127/140 (90.71%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy Swiss-Prot
Match: O22647 (40S ribosomal protein S16 OS=Fritillaria agrestis OX=64177 GN=RPS16 PE=2 SV=1) HSP 1 Score: 236.5 bits (602), Expect = 1.8e-61 Identity = 120/145 (82.76%), Postives = 129/145 (88.97%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy Swiss-Prot
Match: Q9SK22 (40S ribosomal protein S16-1 OS=Arabidopsis thaliana OX=3702 GN=RPS16A PE=2 SV=1) HSP 1 Score: 234.6 bits (597), Expect = 6.7e-61 Identity = 114/139 (82.01%), Postives = 125/139 (89.93%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy Swiss-Prot
Match: Q42340 (40S ribosomal protein S16-3 OS=Arabidopsis thaliana OX=3702 GN=RPS16C PE=2 SV=1) HSP 1 Score: 234.2 bits (596), Expect = 8.7e-61 Identity = 113/139 (81.29%), Postives = 125/139 (89.93%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy Swiss-Prot
Match: Q9XEK7 (40S ribosomal protein S16 OS=Syntrichia ruralis OX=38588 GN=RPS16 PE=2 SV=1) HSP 1 Score: 225.3 bits (573), Expect = 4.0e-58 Identity = 112/142 (78.87%), Postives = 127/142 (89.44%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy TrEMBL
Match: A0A6J1J781 (40S ribosomal protein S16-like OS=Cucurbita maxima OX=3661 GN=LOC111481879 PE=3 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 1.3e-67 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy TrEMBL
Match: A0A0A0L6F6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G202730 PE=3 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 1.3e-67 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy TrEMBL
Match: A0A1S3C210 (40S ribosomal protein S16 OS=Cucumis melo OX=3656 GN=LOC103496134 PE=3 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 1.3e-67 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy TrEMBL
Match: A0A6J1D637 (40S ribosomal protein S16 OS=Momordica charantia OX=3673 GN=LOC111017623 PE=3 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 1.3e-67 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. ExPASy TrEMBL
Match: A0A6J1FW85 (40S ribosomal protein S16-like OS=Cucurbita moschata OX=3662 GN=LOC111447898 PE=3 SV=1) HSP 1 Score: 265.4 bits (677), Expect = 1.3e-67 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. NCBI nr
Match: XP_004136973.1 (40S ribosomal protein S16 [Cucumis sativus] >XP_004140706.1 40S ribosomal protein S16 [Cucumis sativus] >XP_004149967.1 40S ribosomal protein S16 [Cucumis sativus] >XP_008454961.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456099.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456141.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_022136342.1 40S ribosomal protein S16 [Momordica charantia] >XP_022149129.1 40S ribosomal protein S16 [Momordica charantia] >XP_022927908.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022943042.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022943043.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022952362.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022972375.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_022983243.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_023535994.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >XP_023553863.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >XP_038877987.1 40S ribosomal protein S16 [Benincasa hispida] >XP_038880326.1 40S ribosomal protein S16 [Benincasa hispida] >XP_038886975.1 40S ribosomal protein S16 [Benincasa hispida] >KAA0031306.1 40S ribosomal protein S16 [Cucumis melo var. makuwa] >KAG6571970.1 40S ribosomal protein S16, partial [Cucurbita argyrosperma subsp. sororia] >KAG7011649.1 40S ribosomal protein S16, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAA0037136.1 40S ribosomal protein S16 [Cucumis melo var. makuwa] >KAA0039084.1 40S ribosomal protein S16 [Cucumis melo var. makuwa]) HSP 1 Score: 265 bits (678), Expect = 2.90e-89 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. NCBI nr
Match: XP_022149351.1 (40S ribosomal protein S16-like [Momordica charantia]) HSP 1 Score: 265 bits (677), Expect = 4.13e-89 Identity = 133/144 (92.36%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. NCBI nr
Match: XP_022989000.1 (40S ribosomal protein S16-like [Cucurbita maxima]) HSP 1 Score: 264 bits (675), Expect = 8.33e-89 Identity = 133/144 (92.36%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. NCBI nr
Match: XP_040987369.1 (40S ribosomal protein S16 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 264 bits (674), Expect = 1.18e-88 Identity = 132/144 (91.67%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. NCBI nr
Match: KAE8645860.1 (hypothetical protein Csa_017052 [Cucumis sativus]) HSP 1 Score: 265 bits (678), Expect = 1.54e-88 Identity = 134/144 (93.06%), Postives = 134/144 (93.06%), Query Frame = 0
BLAST of IVF0004461 vs. TAIR 10
Match: AT2G09990.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 234.6 bits (597), Expect = 4.7e-62 Identity = 114/139 (82.01%), Postives = 125/139 (89.93%), Query Frame = 0
BLAST of IVF0004461 vs. TAIR 10
Match: AT5G18380.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 234.2 bits (596), Expect = 6.2e-62 Identity = 113/139 (81.29%), Postives = 125/139 (89.93%), Query Frame = 0
BLAST of IVF0004461 vs. TAIR 10
Match: AT3G04230.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 221.1 bits (562), Expect = 5.4e-58 Identity = 108/139 (77.70%), Postives = 120/139 (86.33%), Query Frame = 0
BLAST of IVF0004461 vs. TAIR 10
Match: AT5G18380.2 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 201.8 bits (512), Expect = 3.4e-52 Identity = 98/125 (78.40%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of IVF0004461 vs. TAIR 10
Match: AT5G18380.3 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 172.2 bits (435), Expect = 2.9e-43 Identity = 83/108 (76.85%), Postives = 94/108 (87.04%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|