IVF0024493 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCATCACCAATTTTTTTACCGCCCCTCTTACCGTTGCCACCATCGCCGTTGCCGCCGTTGCACTCACCGATCGTACTTCCTCGCTCCATCGAGGATTTGCTGATGCTCTCCATGTTTATTCTCTTAGTCATTGCCATTTTATGTGGCAAACGGTCTACCAAATCTGACGAGGAAGAGTTGTTGTTGGAGAATCTGGACATTCAAGCATCGATTTTTTCATTATGGCGTAGATGGAAACGGCGAACAAGAATGTGCAATTTGCCTTTACAAAATTGAAGAATGAGAGAAGTGTAGAAAGATGAAGACATGTGGTCACGTGTTTCATAAAGACTGCATTGATCGATGGTTTACGGTGGAGCTTCATTGTCCACTTTGTCGGACGTCGGTTTGTGTGGTAGTTGATCGCAGTGAAAATGCGATGACTTCTCTTCATTCTTTCTGA ATGTCATCACCAATTTTTTTACCGCCCCTCTTACCGTTGCCACCATCGCCGTTGCCGCCGTTGCACTCACCGATCGTACTTCCTCGCTCCATCGAGGATTTGCTGATGCTCTCCATGTTTATTCTCTTAGTCATTGCCATTTTATGTGGCAAACGGTCTACCAAATCTGACGAGGAAGAGTTGTTGTTGGAGAATCTGGACATTCAAGCATCGATTTTTTCATTATGGCAGAAGTGTAGAAAGATGAAGACATGTGGTCACGTGTTTCATAAAGACTGCATTGATCGATGGTTTACGGTGGAGCTTCATTGTCCACTTTGTCGGACGTCGGTTTGTGTGGTAGTTGATCGCAGTGAAAATGCGATGACTTCTCTTCATTCTTTCTGA ATGTCATCACCAATTTTTTTACCGCCCCTCTTACCGTTGCCACCATCGCCGTTGCCGCCGTTGCACTCACCGATCGTACTTCCTCGCTCCATCGAGGATTTGCTGATGCTCTCCATGTTTATTCTCTTAGTCATTGCCATTTTATGTGGCAAACGGTCTACCAAATCTGACGAGGAAGAGTTGTTGTTGGAGAATCTGGACATTCAAGCATCGATTTTTTCATTATGGCAGAAGTGTAGAAAGATGAAGACATGTGGTCACGTGTTTCATAAAGACTGCATTGATCGATGGTTTACGGTGGAGCTTCATTGTCCACTTTGTCGGACGTCGGTTTGTGTGGTAGTTGATCGCAGTGAAAATGCGATGACTTCTCTTCATTCTTTCTGA MSSPIFLPPLLPLPPSPLPPLHSPIVLPRSIEDLLMLSMFILLVIAILCGKRSTKSDEEELLLENLDIQASIFSLWQKCRKMKTCGHVFHKDCIDRWFTVELHCPLCRTSVCVVVDRSENAMTSLHSF Homology
BLAST of IVF0024493 vs. ExPASy Swiss-Prot
Match: Q9LUZ9 (RING-H2 finger protein ATL63 OS=Arabidopsis thaliana OX=3702 GN=ATL63 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.3e-07 Identity = 25/73 (34.25%), Postives = 39/73 (53.42%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy Swiss-Prot
Match: Q9LSW9 (RING-H2 finger protein ATL16 OS=Arabidopsis thaliana OX=3702 GN=ATL16 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 5.8e-06 Identity = 23/55 (41.82%), Postives = 30/55 (54.55%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy Swiss-Prot
Match: Q9LZJ6 (RING-H2 finger protein ATL5 OS=Arabidopsis thaliana OX=3702 GN=ATL5 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 5.8e-06 Identity = 23/49 (46.94%), Postives = 26/49 (53.06%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy Swiss-Prot
Match: Q9SN27 (E3 ubiquitin-protein ligase ATL59 OS=Arabidopsis thaliana OX=3702 GN=ATL59 PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.6e-06 Identity = 21/49 (42.86%), Postives = 29/49 (59.18%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy Swiss-Prot
Match: Q9SRM0 (RING-H2 finger protein ATL66 OS=Arabidopsis thaliana OX=3702 GN=ATL66 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.6e-06 Identity = 22/67 (32.84%), Postives = 34/67 (50.75%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy TrEMBL
Match: A0A5D3BEE2 (RING-type E3 ubiquitin transferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G002240 PE=3 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 1.6e-46 Identity = 107/151 (70.86%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy TrEMBL
Match: A0A1S3C6H2 (RING-type E3 ubiquitin transferase OS=Cucumis melo OX=3656 GN=LOC103497232 PE=3 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 1.6e-46 Identity = 107/151 (70.86%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy TrEMBL
Match: A0A5A7VKL1 (RING-type E3 ubiquitin transferase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold352G00600 PE=3 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 2.7e-46 Identity = 109/151 (72.19%), Postives = 114/151 (75.50%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy TrEMBL
Match: A0A5D3BG26 (RING-type E3 ubiquitin transferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G002250 PE=3 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 7.8e-46 Identity = 108/151 (71.52%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. ExPASy TrEMBL
Match: A0A1S3C741 (RING-type E3 ubiquitin transferase OS=Cucumis melo OX=3656 GN=LOC103497233 PE=3 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 7.8e-46 Identity = 108/151 (71.52%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. NCBI nr
Match: XP_008457566.1 (PREDICTED: RING-H2 finger protein ATL64-like [Cucumis melo] >TYJ97404.1 RING-H2 finger protein ATL64-like [Cucumis melo var. makuwa]) HSP 1 Score: 191 bits (486), Expect = 6.19e-60 Identity = 107/151 (70.86%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. NCBI nr
Match: KAA0067740.1 (RING-H2 finger protein ATL63-like [Cucumis melo var. makuwa]) HSP 1 Score: 191 bits (484), Expect = 1.21e-59 Identity = 109/151 (72.19%), Postives = 114/151 (75.50%), Query Frame = 0
BLAST of IVF0024493 vs. NCBI nr
Match: XP_008457567.1 (PREDICTED: RING-H2 finger protein ATL63-like [Cucumis melo] >TYJ97405.1 RING-H2 finger protein ATL63-like [Cucumis melo var. makuwa]) HSP 1 Score: 189 bits (480), Expect = 4.91e-59 Identity = 108/151 (71.52%), Postives = 113/151 (74.83%), Query Frame = 0
BLAST of IVF0024493 vs. NCBI nr
Match: KAA0067739.1 (RING-H2 finger protein ATL64-like [Cucumis melo var. makuwa]) HSP 1 Score: 188 bits (477), Expect = 1.41e-58 Identity = 107/151 (70.86%), Postives = 112/151 (74.17%), Query Frame = 0
BLAST of IVF0024493 vs. NCBI nr
Match: XP_011659858.1 (E3 ubiquitin-protein ligase ATL9-like [Cucumis sativus]) HSP 1 Score: 140 bits (352), Expect = 1.19e-39 Identity = 84/141 (59.57%), Postives = 92/141 (65.25%), Query Frame = 0
BLAST of IVF0024493 vs. TAIR 10
Match: AT5G58580.1 (TOXICOS EN LEVADURA 63 ) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-08 Identity = 25/73 (34.25%), Postives = 39/73 (53.42%), Query Frame = 0
BLAST of IVF0024493 vs. TAIR 10
Match: AT3G62690.1 (AtL5 ) HSP 1 Score: 52.0 bits (123), Expect = 4.2e-07 Identity = 23/49 (46.94%), Postives = 26/49 (53.06%), Query Frame = 0
BLAST of IVF0024493 vs. TAIR 10
Match: AT5G43420.1 (RING/U-box superfamily protein ) HSP 1 Score: 52.0 bits (123), Expect = 4.2e-07 Identity = 23/55 (41.82%), Postives = 30/55 (54.55%), Query Frame = 0
BLAST of IVF0024493 vs. TAIR 10
Match: AT3G11110.1 (RING/U-box superfamily protein ) HSP 1 Score: 51.6 bits (122), Expect = 5.4e-07 Identity = 22/67 (32.84%), Postives = 34/67 (50.75%), Query Frame = 0
BLAST of IVF0024493 vs. TAIR 10
Match: AT4G10160.1 (RING/U-box superfamily protein ) HSP 1 Score: 51.6 bits (122), Expect = 5.4e-07 Identity = 21/49 (42.86%), Postives = 29/49 (59.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|