MS016892 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTAGACTGCGGCGGCGCGTGCGCGGGGAGGTGCCGGCTGTCGTCGAGGCCGCGGCTGTGCAATAGGGCGTGCGGGACGTGCTGTCAGCGCTGCAACTGCGTTCCGCCGGGAACCTCCGGAAACCACCACCTCTGCCCTTGCTACGCCGCCATGACCACCCACGGCGGCCGCCCCAAATGCCCC TTAGACTGCGGCGGCGCGTGCGCGGGGAGGTGCCGGCTGTCGTCGAGGCCGCGGCTGTGCAATAGGGCGTGCGGGACGTGCTGTCAGCGCTGCAACTGCGTTCCGCCGGGAACCTCCGGAAACCACCACCTCTGCCCTTGCTACGCCGCCATGACCACCCACGGCGGCCGCCCCAAATGCCCC TTAGACTGCGGCGGCGCGTGCGCGGGGAGGTGCCGGCTGTCGTCGAGGCCGCGGCTGTGCAATAGGGCGTGCGGGACGTGCTGTCAGCGCTGCAACTGCGTTCCGCCGGGAACCTCCGGAAACCACCACCTCTGCCCTTGCTACGCCGCCATGACCACCCACGGCGGCCGCCCCAAATGCCCC LDCGGACAGRCRLSSRPRLCNRACGTCCQRCNCVPPGTSGNHHLCPCYAAMTTHGGRPKCP Homology
BLAST of MS016892 vs. NCBI nr
Match: XP_022144284.1 (snakin-2-like [Momordica charantia]) HSP 1 Score: 141.7 bits (356), Expect = 2.0e-30 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS016892 vs. NCBI nr
Match: XP_038886089.1 (snakin-2-like isoform X2 [Benincasa hispida]) HSP 1 Score: 133.3 bits (334), Expect = 7.2e-28 Identity = 57/61 (93.44%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. NCBI nr
Match: XP_038886088.1 (snakin-2-like isoform X1 [Benincasa hispida]) HSP 1 Score: 133.3 bits (334), Expect = 7.2e-28 Identity = 57/61 (93.44%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. NCBI nr
Match: XP_023002563.1 (snakin-2-like [Cucurbita maxima]) HSP 1 Score: 131.3 bits (329), Expect = 2.8e-27 Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. NCBI nr
Match: XP_022951559.1 (snakin-2-like [Cucurbita moschata] >KAG6585544.1 Snakin-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7020456.1 Snakin-2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 130.6 bits (327), Expect = 4.7e-27 Identity = 54/61 (88.52%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. ExPASy Swiss-Prot
Match: Q93X17 (Snakin-2 OS=Solanum tuberosum OX=4113 GN=SN2 PE=1 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 1.9e-26 Identity = 50/61 (81.97%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of MS016892 vs. ExPASy Swiss-Prot
Match: P46687 (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana OX=3702 GN=GASA3 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 5.1e-24 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MS016892 vs. ExPASy Swiss-Prot
Match: P46689 (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana OX=3702 GN=GASA1 PE=2 SV=2) HSP 1 Score: 110.2 bits (274), Expect = 8.6e-24 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MS016892 vs. ExPASy Swiss-Prot
Match: P46688 (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana OX=3702 GN=GASA2 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 9.5e-23 Identity = 45/61 (73.77%), Postives = 50/61 (81.97%), Query Frame = 0
BLAST of MS016892 vs. ExPASy Swiss-Prot
Match: F4IQJ4 (Gibberellin-regulated protein 11 OS=Arabidopsis thaliana OX=3702 GN=GASA11 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.1e-21 Identity = 43/61 (70.49%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of MS016892 vs. ExPASy TrEMBL
Match: A0A6J1CRW3 (snakin-2-like OS=Momordica charantia OX=3673 GN=LOC111014004 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 9.9e-31 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS016892 vs. ExPASy TrEMBL
Match: A0A6J1KTY1 (snakin-2-like OS=Cucurbita maxima OX=3661 GN=LOC111496372 PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.3e-27 Identity = 55/61 (90.16%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. ExPASy TrEMBL
Match: A0A6J1GJ50 (snakin-2-like OS=Cucurbita moschata OX=3662 GN=LOC111454338 PE=3 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 2.3e-27 Identity = 54/61 (88.52%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of MS016892 vs. ExPASy TrEMBL
Match: A0A0A0LNS5 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G368260 PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.5e-26 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS016892 vs. ExPASy TrEMBL
Match: A0A1S3BBY7 (snakin-2-like OS=Cucumis melo OX=3656 GN=LOC103488041 PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.5e-26 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MS016892 vs. TAIR 10
Match: AT4G09600.1 (GAST1 protein homolog 3 ) HSP 1 Score: 110.9 bits (276), Expect = 3.6e-25 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MS016892 vs. TAIR 10
Match: AT1G75750.1 (GAST1 protein homolog 1 ) HSP 1 Score: 110.2 bits (274), Expect = 6.1e-25 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MS016892 vs. TAIR 10
Match: AT1G75750.2 (GAST1 protein homolog 1 ) HSP 1 Score: 110.2 bits (274), Expect = 6.1e-25 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of MS016892 vs. TAIR 10
Match: AT4G09610.1 (GAST1 protein homolog 2 ) HSP 1 Score: 106.7 bits (265), Expect = 6.8e-24 Identity = 45/61 (73.77%), Postives = 50/61 (81.97%), Query Frame = 0
BLAST of MS016892 vs. TAIR 10
Match: AT2G18420.1 (Gibberellin-regulated family protein ) HSP 1 Score: 103.2 bits (256), Expect = 7.5e-23 Identity = 43/61 (70.49%), Postives = 48/61 (78.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|