MC09g1774 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAATTCCGGTGCGCTGTTTCACGTGCGGCAAGGTATTACTTCCGCTTCAATCGCTTTTTTCCTTATTTGATCGGCCATCGCCGTTCCTTCAATGGCTAAGGAAATTAATCTTCAGCTTTCTCTGCATTATTATAAGGAAACTCTGTTTGTATCCGTATTGTGTTTAATTTTATGTTCTGTTTTTTCTTTTTTTTTTTCAGGTGATCGGTAACAAATGGGACTCTTATCTAGAGCTTCTGCAAGCAGACTATCCGGAAGGGTAAAATAGAACGCCGAATTGGCTTCAATTCGTCTATTTCTAATTCCTCTTTCATAATCTTGTTAAATTCTGCTAACACAATCGTTCTGAATTTGCATTATGCAAGTATTTTGAGTTTGCGTAGGATCGTTTCATGTATTGAAATTTTTGCGATAACAGCCACGATTGGTAAAAAAAGTATATATTAATAGGATTGAAAAAGATGAAAACATAGTGATTTTTGGTGCGGTGCAGGGAGGCGTTGGATTTATTAGGGCTAGTTCGGTATTGCTGTCGGCGGATGCTTATGACTCATGTGGATCTGATCGAGAAGCTGTTGAACTACAACAGT ATGATAATTCCGGTGCGCTGTTTCACGTGCGGCAAGGTGATCGGTAACAAATGGGACTCTTATCTAGAGCTTCTGCAAGCAGACTATCCGGAAGGGGAGGCGTTGGATTTATTAGGGCTAGTTCGGTATTGCTGTCGGCGGATGCTTATGACTCATGTGGATCTGATCGAGAAGCTGTTGAACTACAACAGT ATGATAATTCCGGTGCGCTGTTTCACGTGCGGCAAGGTGATCGGTAACAAATGGGACTCTTATCTAGAGCTTCTGCAAGCAGACTATCCGGAAGGGGAGGCGTTGGATTTATTAGGGCTAGTTCGGTATTGCTGTCGGCGGATGCTTATGACTCATGTGGATCTGATCGAGAAGCTGTTGAACTACAACAGT MIIPVRCFTCGKVIGNKWDSYLELLQADYPEGEALDLLGLVRYCCRRMLMTHVDLIEKLLNYNS Homology
BLAST of MC09g1774 vs. ExPASy Swiss-Prot
Match: Q9SYA6 (DNA-directed RNA polymerase subunit 10-like protein OS=Arabidopsis thaliana OX=3702 GN=NRPB10L PE=1 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 2.9e-30 Identity = 58/64 (90.62%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy Swiss-Prot
Match: Q39290 (DNA-directed RNA polymerases I, II, and III subunit RPABC5 OS=Brassica napus OX=3708 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 9.3e-29 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy Swiss-Prot
Match: Q8LFJ6 (DNA-directed RNA polymerases II, IV and V subunit 10 OS=Arabidopsis thaliana OX=3702 GN=NRPB10 PE=1 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy Swiss-Prot
Match: Q55AB6 (DNA-directed RNA polymerases I, II, and III subunit rpabc5 OS=Dictyostelium discoideum OX=44689 GN=polr2l PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 2.5e-26 Identity = 53/62 (85.48%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy Swiss-Prot
Match: Q9VC49 (DNA-directed RNA polymerases I, II, and III subunit RPABC5 OS=Drosophila melanogaster OX=7227 GN=Rpb10 PE=3 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 3.3e-26 Identity = 52/62 (83.87%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MC09g1774 vs. NCBI nr
Match: XP_022151052.1 (DNA-directed RNA polymerase subunit 10-like protein [Momordica charantia]) HSP 1 Score: 140 bits (352), Expect = 8.53e-42 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC09g1774 vs. NCBI nr
Match: XP_038893151.1 (DNA-directed RNA polymerase subunit 10-like protein [Benincasa hispida]) HSP 1 Score: 138 bits (347), Expect = 4.95e-41 Identity = 61/64 (95.31%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC09g1774 vs. NCBI nr
Match: XP_004135479.1 (DNA-directed RNA polymerase subunit 10-like protein [Cucumis sativus] >KGN51793.1 hypothetical protein Csa_009052 [Cucumis sativus]) HSP 1 Score: 137 bits (344), Expect = 1.42e-40 Identity = 60/64 (93.75%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC09g1774 vs. NCBI nr
Match: XP_008446194.1 (PREDICTED: DNA-directed RNA polymerase subunit 10-like protein [Cucumis melo] >KAA0034305.1 DNA-directed RNA polymerase subunit 10-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 135 bits (341), Expect = 4.08e-40 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MC09g1774 vs. NCBI nr
Match: EFJ10727.1 (hypothetical protein SELMODRAFT_127452 [Selaginella moellendorffii] >EFJ35775.1 hypothetical protein SELMODRAFT_79899 [Selaginella moellendorffii]) HSP 1 Score: 134 bits (338), Expect = 9.91e-40 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy TrEMBL
Match: A0A6J1DCG7 (DNA-directed RNA polymerase subunit 10-like protein OS=Momordica charantia OX=3673 GN=LOC111019076 PE=3 SV=1) HSP 1 Score: 140 bits (352), Expect = 4.13e-42 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy TrEMBL
Match: A0A0A0KQ80 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G600940 PE=3 SV=1) HSP 1 Score: 137 bits (344), Expect = 6.87e-41 Identity = 60/64 (93.75%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy TrEMBL
Match: A0A5A7SYN0 (DNA-directed RNA polymerase subunit 10-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold65G003050 PE=3 SV=1) HSP 1 Score: 135 bits (341), Expect = 1.97e-40 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy TrEMBL
Match: A0A1S3BEG8 (DNA-directed RNA polymerase subunit 10-like protein OS=Cucumis melo OX=3656 GN=LOC103488997 PE=3 SV=1) HSP 1 Score: 135 bits (341), Expect = 1.97e-40 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MC09g1774 vs. ExPASy TrEMBL
Match: D8QXA0 (Uncharacterized protein OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_127452 PE=3 SV=1) HSP 1 Score: 134 bits (338), Expect = 4.80e-40 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MC09g1774 vs. TAIR 10
Match: AT1G61700.1 (RNA polymerases N / 8 kDa subunit ) HSP 1 Score: 131.7 bits (330), Expect = 2.1e-31 Identity = 58/64 (90.62%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MC09g1774 vs. TAIR 10
Match: AT1G11475.1 (RNA polymerases N / 8 kDa subunit ) HSP 1 Score: 125.6 bits (314), Expect = 1.5e-29 Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|