Csor.00g163120 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTGTCGCTATCGTCGCTCGCGGTGGCAACCCAACATTTAGATTTGGTGGGCAGCTACAAACCAATAAAAAACATAGATGAGCCACAGATTCAAAGCTTAGGTGAGTTCGCAGTGAATGAACACAATAAACATGCAAAAACTCAGCTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGCACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAGTAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTCGACGTCCCCAACTAG ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTGTCGCTATCGTCGCTCGCGGTGGCAACCCAACATTTAGATTTGGTGGGCAGCTACAAACCAATAAAAAACATAGATGAGCCACAGATTCAAAGCTTAGGTGAGTTCGCAGTGAATGAACACAATAAACATGCAAAAACTCAGCTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGCACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAGTAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTCGACGTCCCCAACTAG ATGGCTAAGGCTCTTTTCTTCGTGGCTTCTCTTCTCCTCTACGTCCTGTCGCTATCGTCGCTCGCGGTGGCAACCCAACATTTAGATTTGGTGGGCAGCTACAAACCAATAAAAAACATAGATGAGCCACAGATTCAAAGCTTAGGTGAGTTCGCAGTGAATGAACACAATAAACATGCAAAAACTCAGCTCCAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGCACCAACTATAACCTTCGATTGACAGCTCTTGAGGGGACTAGTAGCCGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTTCGACGTCCCCAACTAG MAKALFFVASLLLYVLSLSSLAVATQHLDLVGSYKPIKNIDEPQIQSLGEFAVNEHNKHAKTQLQFQKVISGEMQIVAGTNYNLRLTALEGTSSRTYGTLVFTDLNNKNNLINFFDVPN Homology
BLAST of Csor.00g163120 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 7.8e-13 Identity = 37/92 (40.22%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 36/92 (39.13%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 72.0 bits (175), Expect = 5.1e-12 Identity = 41/103 (39.81%), Postives = 65/103 (63.11%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 9.6e-11 Identity = 27/61 (44.26%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-09 Identity = 39/98 (39.80%), Postives = 56/98 (57.14%), Query Frame = 0
BLAST of Csor.00g163120 vs. NCBI nr
Match: KAG6583735.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 226 bits (576), Expect = 2.46e-74 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of Csor.00g163120 vs. NCBI nr
Match: XP_023520844.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 215 bits (547), Expect = 6.51e-70 Identity = 113/119 (94.96%), Postives = 116/119 (97.48%), Query Frame = 0
BLAST of Csor.00g163120 vs. NCBI nr
Match: XP_023520237.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023520238.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 213 bits (542), Expect = 3.77e-69 Identity = 113/119 (94.96%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of Csor.00g163120 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 213 bits (541), Expect = 5.36e-69 Identity = 113/119 (94.96%), Postives = 114/119 (95.80%), Query Frame = 0
BLAST of Csor.00g163120 vs. NCBI nr
Match: XP_022975293.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 208 bits (529), Expect = 3.62e-67 Identity = 109/118 (92.37%), Postives = 112/118 (94.92%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 213 bits (541), Expect = 2.59e-69 Identity = 113/119 (94.96%), Postives = 114/119 (95.80%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy TrEMBL
Match: A0A6J1IIS7 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474432 PE=4 SV=1) HSP 1 Score: 208 bits (529), Expect = 1.75e-67 Identity = 109/118 (92.37%), Postives = 112/118 (94.92%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 207 bits (526), Expect = 5.03e-67 Identity = 111/119 (93.28%), Postives = 112/119 (94.12%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy TrEMBL
Match: A0A6J1IC30 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111471626 PE=4 SV=1) HSP 1 Score: 195 bits (496), Expect = 1.89e-62 Identity = 104/114 (91.23%), Postives = 107/114 (93.86%), Query Frame = 0
BLAST of Csor.00g163120 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 194 bits (494), Expect = 3.81e-62 Identity = 103/117 (88.03%), Postives = 108/117 (92.31%), Query Frame = 0
BLAST of Csor.00g163120 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 72.0 bits (175), Expect = 3.6e-13 Identity = 41/103 (39.81%), Postives = 65/103 (63.11%), Query Frame = 0
BLAST of Csor.00g163120 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 6.8e-12 Identity = 27/61 (44.26%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Csor.00g163120 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 55.1 bits (131), Expect = 4.6e-08 Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of Csor.00g163120 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 52.4 bits (124), Expect = 3.0e-07 Identity = 23/69 (33.33%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of Csor.00g163120 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 51.2 bits (121), Expect = 6.6e-07 Identity = 33/105 (31.43%), Postives = 57/105 (54.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|