Cp4.1LG19g02990 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCGACTTTCATCGGAAATTCCACATCGATTCAGGAAATGTTCCGACGTGTGAGCGAACAGTTCACTGCCATGTTTAGGAGGAAAGCTTTCTTGCATTGGTACACCGGTGAAGGTATGGACGAGATGGAGTTCACCGAGGCCGAAAGTAACATGAACGATCTGGTTTCGGAATACCAGCAGTACCAAGATGCCACAGCTGATGAGGAATATTACGAGGAAGAAGAAGAAGAGGAACCTGAAGATGTGTAA ATGGCTTCGACTTTCATCGGAAATTCCACATCGATTCAGGAAATGTTCCGACGTGTGAGCGAACAGTTCACTGCCATGTTTAGGAGGAAAGCTTTCTTGCATTGGTACACCGGTGAAGGTATGGACGAGATGGAGTTCACCGAGGCCGAAAGTAACATGAACGATCTGGTTTCGGAATACCAGCAGTACCAAGATGCCACAGCTGATGAGGAATATTACGAGGAAGAAGAAGAAGAGGAACCTGAAGATGTGTAA ATGGCTTCGACTTTCATCGGAAATTCCACATCGATTCAGGAAATGTTCCGACGTGTGAGCGAACAGTTCACTGCCATGTTTAGGAGGAAAGCTTTCTTGCATTGGTACACCGGTGAAGGTATGGACGAGATGGAGTTCACCGAGGCCGAAAGTAACATGAACGATCTGGTTTCGGAATACCAGCAGTACCAAGATGCCACAGCTGATGAGGAATATTACGAGGAAGAAGAAGAAGAGGAACCTGAAGATGTGTAA MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEYYEEEEEEEPEDV Homology
BLAST of Cp4.1LG19g02990 vs. ExPASy Swiss-Prot
Match: P12460 (Tubulin beta-2 chain OS=Glycine max OX=3847 GN=TUBB2 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 5.1e-35 Identity = 78/80 (97.50%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy Swiss-Prot
Match: P29502 (Tubulin beta-3 chain (Fragment) OS=Pisum sativum OX=3888 GN=TUBB3 PE=2 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-34 Identity = 80/83 (96.39%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy Swiss-Prot
Match: P20364 (Tubulin beta-1 chain (Fragment) OS=Daucus carota OX=4039 GN=TUBB1 PE=1 SV=2) HSP 1 Score: 146.0 bits (367), Expect = 2.0e-34 Identity = 79/83 (95.18%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy Swiss-Prot
Match: Q41783 (Tubulin beta-6 chain OS=Zea mays OX=4577 GN=TUBB6 PE=2 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.5e-34 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy Swiss-Prot
Match: Q40665 (Tubulin beta-3 chain OS=Oryza sativa subsp. japonica OX=39947 GN=TUBB3 PE=2 SV=2) HSP 1 Score: 144.8 bits (364), Expect = 4.3e-34 Identity = 76/80 (95.00%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. NCBI nr
Match: XP_022931923.1 (tubulin beta-1 chain [Cucurbita moschata] >XP_023518313.1 tubulin beta-1 chain [Cucurbita pepo subsp. pepo] >KAG6595372.1 Tubulin beta-1 chain, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 160 bits (405), Expect = 3.59e-45 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. NCBI nr
Match: TKY72401.1 (Tubulin beta-4 chain [Spatholobus suberectus]) HSP 1 Score: 149 bits (375), Expect = 8.90e-45 Identity = 78/80 (97.50%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. NCBI nr
Match: AFK39312.1 (unknown [Medicago truncatula]) HSP 1 Score: 148 bits (374), Expect = 1.23e-44 Identity = 78/80 (97.50%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. NCBI nr
Match: AFK38702.1 (unknown [Lotus japonicus]) HSP 1 Score: 149 bits (376), Expect = 1.71e-44 Identity = 77/81 (95.06%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. NCBI nr
Match: PON37100.1 (beta-tubulin [Parasponia andersonii] >PON90166.1 beta-tubulin [Trema orientale]) HSP 1 Score: 148 bits (373), Expect = 1.80e-44 Identity = 77/84 (91.67%), Postives = 82/84 (97.62%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy TrEMBL
Match: A0A6J1F050 (Tubulin beta chain OS=Cucurbita moschata OX=3662 GN=LOC111438199 PE=3 SV=1) HSP 1 Score: 160 bits (405), Expect = 1.74e-45 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy TrEMBL
Match: I3SGC0 (Uncharacterized protein OS=Medicago truncatula OX=3880 PE=2 SV=1) HSP 1 Score: 148 bits (374), Expect = 5.94e-45 Identity = 78/80 (97.50%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy TrEMBL
Match: I3SEL0 (Tubulin_C domain-containing protein OS=Lotus japonicus OX=34305 PE=2 SV=1) HSP 1 Score: 149 bits (376), Expect = 8.28e-45 Identity = 77/81 (95.06%), Postives = 80/81 (98.77%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy TrEMBL
Match: A0A2P5AKM7 (Beta-tubulin OS=Parasponia andersonii OX=3476 GN=PanWU01x14_322960 PE=3 SV=1) HSP 1 Score: 148 bits (373), Expect = 8.70e-45 Identity = 77/84 (91.67%), Postives = 82/84 (97.62%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. ExPASy TrEMBL
Match: A0A2P5EXA8 (Beta-tubulin OS=Trema orientale OX=63057 GN=TorRG33x02_140160 PE=3 SV=1) HSP 1 Score: 148 bits (373), Expect = 8.70e-45 Identity = 77/84 (91.67%), Postives = 82/84 (97.62%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. TAIR 10
Match: AT5G44340.1 (tubulin beta chain 4 ) HSP 1 Score: 144.1 bits (362), Expect = 5.3e-35 Identity = 76/79 (96.20%), Postives = 77/79 (97.47%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. TAIR 10
Match: AT4G20890.1 (tubulin beta-9 chain ) HSP 1 Score: 142.5 bits (358), Expect = 1.5e-34 Identity = 75/80 (93.75%), Postives = 77/80 (96.25%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. TAIR 10
Match: AT5G12250.1 (beta-6 tubulin ) HSP 1 Score: 141.0 bits (354), Expect = 4.5e-34 Identity = 76/81 (93.83%), Postives = 79/81 (97.53%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. TAIR 10
Match: AT1G75780.1 (tubulin beta-1 chain ) HSP 1 Score: 140.6 bits (353), Expect = 5.8e-34 Identity = 75/80 (93.75%), Postives = 78/80 (97.50%), Query Frame = 0
BLAST of Cp4.1LG19g02990 vs. TAIR 10
Match: AT5G62690.1 (tubulin beta chain 2 ) HSP 1 Score: 140.2 bits (352), Expect = 7.6e-34 Identity = 77/81 (95.06%), Postives = 78/81 (96.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|