![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO.jh018417.1.t1 (mRNA) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.GCTAGAGAAGGTGTGAAGATTGAACATGAAAAGAAATTGTCATTGTTGCAGAGTCAGGAATACAAGGGGGAGGATGAAAGCAAGCTAGATAAGATGAAGGCTGCTATAACTAGACTGCAGTCACTAATTATTGTCACATCCCAAGCTGTCAATACAACTTCTACTGCCATAGTTGGACTAAGAAATTCGGATCTCATTCCTCAGCTTGTTGAACTTTGCCATGGGTAA GCTAGAGAAGGTGTGAAGATTGAACATGAAAAGAAATTGTCATTGTTGCAGAGTCAGGAATACAAGGGGGAGGATGAAAGCAAGCTAGATAAGATGAAGGCTGCTATAACTAGACTGCAGTCACTAATTATTGTCACATCCCAAGCTGTCAATACAACTTCTACTGCCATAGTTGGACTAAGAAATTCGGATCTCATTCCTCAGCTTGTTGAACTTTGCCATGGGTAA ATGAAGGCTGCTATAACTAGACTGCAGTCACTAATTATTGTCACATCCCAAGCTGTCAATACAACTTCTACTGCCATAGTTGGACTAAGAAATTCGGATCTCATTCCTCAGCTTGTTGAACTTTGCCATGGGTAA MKAAITRLQSLIIVTSQAVNTTSTAIVGLRNSDLIPQLVELCHG Homology
BLAST of MELO.jh018417.1.t1 vs. NCBI nr
Match: TYK05325.1 (bZIP protein [Cucumis melo var. makuwa]) HSP 1 Score: 82.4 bits (202), Expect = 2.91e-18 Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. NCBI nr
Match: KAA0044264.1 (histone-lysine N-methyltransferase SETD2-like [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 1.04e-17 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. NCBI nr
Match: KAA0042925.1 (bZIP protein [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 1.16e-17 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. NCBI nr
Match: KAA0047058.1 (protein DETOXIFICATION 31-like [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 2.11e-17 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. NCBI nr
Match: TYK24716.1 (putative helicase CHR10 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 80.9 bits (198), Expect = 3.27e-16 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy Swiss-Prot
Match: Q93YU8 (Nitrate regulatory gene2 protein OS=Arabidopsis thaliana OX=3702 GN=NRG2 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 2.4e-12 Identity = 36/43 (83.72%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy Swiss-Prot
Match: Q9AQW1 (Protein ROLLING AND ERECT LEAF 2 OS=Oryza sativa subsp. japonica OX=39947 GN=REL2 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.4e-07 Identity = 29/41 (70.73%), Postives = 36/41 (87.80%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy TrEMBL
Match: A0A5D3C1S3 (BZIP protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold108G001510 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.41e-18 Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7TM53 (Histone-lysine N-methyltransferase SETD2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2741G00230 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.02e-18 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7TND8 (BZIP protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold44G004480 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 5.64e-18 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7TVZ4 (Protein DETOXIFICATION 31-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold466G00120 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.02e-17 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. ExPASy TrEMBL
Match: A0A5D3DM51 (Putative helicase CHR10 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold266G002740 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.59e-16 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. TAIR 10
Match: AT3G60320.1 (Protein of unknown function (DUF630 and DUF632) ) HSP 1 Score: 71.6 bits (174), Expect = 1.7e-13 Identity = 36/43 (83.72%), Postives = 41/43 (95.35%), Query Frame = 0
BLAST of MELO.jh018417.1.t1 vs. TAIR 10
Match: AT1G02110.1 (Protein of unknown function (DUF630 and DUF632) ) HSP 1 Score: 63.5 bits (153), Expect = 4.7e-11 Identity = 32/43 (74.42%), Postives = 39/43 (90.70%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|