
MC11g1399.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TACAGAGGCGTTAGAAAGAGGACATGGGGGAAATGGGCGGCGGAAATCCGAGACCCGACCAAGAAGGCGCAGATATGGCTCGGCAGCTTCGACACGCCGGAGATGGCTGCGGTGGCCTACGACGTCGCCGCCTACTTCTTCCGAGGCCGCCATGCTCGCCTCAACTTCCCGCATCTTGTCGACCTCAACCGCCTACCGTCCCCTCGCAGCTCCAGTGTGGAACACATTCGCGAGGCGGTGCGCGAAGCCCTCCAGGCAATGTGGCCGACGTCGCCGGGCAGTGAAGCTTCTTCG TACAGAGGCGTTAGAAAGAGGACATGGGGGAAATGGGCGGCGGAAATCCGAGACCCGACCAAGAAGGCGCAGATATGGCTCGGCAGCTTCGACACGCCGGAGATGGCTGCGGTGGCCTACGACGTCGCCGCCTACTTCTTCCGAGGCCGCCATGCTCGCCTCAACTTCCCGCATCTTGTCGACCTCAACCGCCTACCGTCCCCTCGCAGCTCCAGTGTGGAACACATTCGCGAGGCGGTGCGCGAAGCCCTCCAGGCAATGTGGCCGACGTCGCCGGGCAGTGAAGCTTCTTCG TACAGAGGCGTTAGAAAGAGGACATGGGGGAAATGGGCGGCGGAAATCCGAGACCCGACCAAGAAGGCGCAGATATGGCTCGGCAGCTTCGACACGCCGGAGATGGCTGCGGTGGCCTACGACGTCGCCGCCTACTTCTTCCGAGGCCGCCATGCTCGCCTCAACTTCCCGCATCTTGTCGACCTCAACCGCCTACCGTCCCCTCGCAGCTCCAGTGTGGAACACATTCGCGAGGCGGTGCGCGAAGCCCTCCAGGCAATGTGGCCGACGTCGCCGGGCAGTGAAGCTTCTTCG YRGVRKRTWGKWAAEIRDPTKKAQIWLGSFDTPEMAAVAYDVAAYFFRGRHARLNFPHLVDLNRLPSPRSSSVEHIREAVREALQAMWPTSPGSEASS Homology
BLAST of MC11g1399.1 vs. ExPASy Swiss-Prot
Match: Q9C9I2 (Ethylene-responsive transcription factor ERF021 OS=Arabidopsis thaliana OX=3702 GN=ERF021 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 4.3e-25 Identity = 59/97 (60.82%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy Swiss-Prot
Match: Q9LQ28 (Ethylene-responsive transcription factor ERF022 OS=Arabidopsis thaliana OX=3702 GN=ERF022 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 50/83 (60.24%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy Swiss-Prot
Match: Q9SUK8 (Ethylene-responsive transcription factor ERF039 OS=Arabidopsis thaliana OX=3702 GN=ERF039 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 52/100 (52.00%), Postives = 64/100 (64.00%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy Swiss-Prot
Match: Q1ECI2 (Ethylene-responsive transcription factor ERF023 OS=Arabidopsis thaliana OX=3702 GN=ERF023 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.2e-20 Identity = 47/87 (54.02%), Postives = 61/87 (70.11%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy Swiss-Prot
Match: P93007 (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana OX=3702 GN=ERF112 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 9.3e-20 Identity = 46/74 (62.16%), Postives = 56/74 (75.68%), Query Frame = 0
BLAST of MC11g1399.1 vs. NCBI nr
Match: XP_022141789.1 (ethylene-responsive transcription factor ERF021-like [Momordica charantia]) HSP 1 Score: 202 bits (515), Expect = 5.34e-65 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of MC11g1399.1 vs. NCBI nr
Match: XP_008459604.1 (PREDICTED: ethylene-responsive transcription factor ERF021 [Cucumis melo] >KAA0039276.1 ethylene-responsive transcription factor ERF021 [Cucumis melo var. makuwa] >TYK00463.1 ethylene-responsive transcription factor ERF021 [Cucumis melo var. makuwa]) HSP 1 Score: 120 bits (302), Expect = 4.31e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. NCBI nr
Match: XP_004141635.1 (ethylene-responsive transcription factor ERF021 [Cucumis sativus]) HSP 1 Score: 120 bits (302), Expect = 4.80e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. NCBI nr
Match: KAE8648999.1 (hypothetical protein Csa_009288 [Cucumis sativus]) HSP 1 Score: 120 bits (302), Expect = 5.07e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. NCBI nr
Match: XP_022772411.1 (ethylene-responsive transcription factor ERF021-like [Durio zibethinus]) HSP 1 Score: 120 bits (300), Expect = 5.41e-32 Identity = 62/98 (63.27%), Postives = 70/98 (71.43%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy TrEMBL
Match: A0A6J1CJT4 (ethylene-responsive transcription factor ERF021-like OS=Momordica charantia OX=3673 GN=LOC111012074 PE=4 SV=1) HSP 1 Score: 202 bits (515), Expect = 2.59e-65 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy TrEMBL
Match: A0A5D3BL30 (Ethylene-responsive transcription factor ERF021 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G00670 PE=4 SV=1) HSP 1 Score: 120 bits (302), Expect = 2.09e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy TrEMBL
Match: A0A1S3CB31 (ethylene-responsive transcription factor ERF021 OS=Cucumis melo OX=3656 GN=LOC103498683 PE=4 SV=1) HSP 1 Score: 120 bits (302), Expect = 2.09e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy TrEMBL
Match: A0A0A0KXW9 (AP2/ERF domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G649890 PE=4 SV=1) HSP 1 Score: 120 bits (302), Expect = 2.33e-32 Identity = 60/83 (72.29%), Postives = 66/83 (79.52%), Query Frame = 0
BLAST of MC11g1399.1 vs. ExPASy TrEMBL
Match: A0A6P6B688 (ethylene-responsive transcription factor ERF021-like OS=Durio zibethinus OX=66656 GN=LOC111315057 PE=4 SV=1) HSP 1 Score: 120 bits (300), Expect = 2.62e-32 Identity = 62/98 (63.27%), Postives = 70/98 (71.43%), Query Frame = 0
BLAST of MC11g1399.1 vs. TAIR 10
Match: AT1G71450.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 115.2 bits (287), Expect = 3.1e-26 Identity = 59/97 (60.82%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of MC11g1399.1 vs. TAIR 10
Match: AT1G33760.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-23 Identity = 50/83 (60.24%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of MC11g1399.1 vs. TAIR 10
Match: AT4G16750.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 99.4 bits (246), Expect = 1.7e-21 Identity = 52/100 (52.00%), Postives = 64/100 (64.00%), Query Frame = 0
BLAST of MC11g1399.1 vs. TAIR 10
Match: AT1G01250.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 98.6 bits (244), Expect = 3.0e-21 Identity = 47/87 (54.02%), Postives = 61/87 (70.11%), Query Frame = 0
BLAST of MC11g1399.1 vs. TAIR 10
Match: AT2G33710.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 97.4 bits (241), Expect = 6.6e-21 Identity = 46/74 (62.16%), Postives = 56/74 (75.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|