
MC04g0013.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGATGGACTCCTTATGGAAATACTAAGTTCATAATTTATAAGCATGCAGCGAGTACACCAGGATGCCAAGTATTTCACACATGTGCTTACAGCAAAGGTATGAATTACGAATGGTAATTTTTGTTTGTTCTGATATCTGCATACAGATTATTACTATATCTCAATGCGATAATGTGCTAAATCCTCGTGCACGCTTGTCAGGGGTTTGCGCCATGTGCGGGAAGCGAGTACTTGACAACAAGTTTTATAAACAAAGCAATGTG AGATGGACTCCTTATGGAAATACTAAGTTCATAATTTATAAGCATGCAGCGAGTACACCAGGATGCCAAGTATTTCACACATGTGCTTACAGCAAAGGGGTTTGCGCCATGTGCGGGAAGCGAGTACTTGACAACAAGTTTTATAAACAAAGCAATGTG AGATGGACTCCTTATGGAAATACTAAGTTCATAATTTATAAGCATGCAGCGAGTACACCAGGATGCCAAGTATTTCACACATGTGCTTACAGCAAAGGGGTTTGCGCCATGTGCGGGAAGCGAGTACTTGACAACAAGTTTTATAAACAAAGCAATGTG RWTPYGNTKFIIYKHAASTPGCQVFHTCAYSKGVCAMCGKRVLDNKFYKQSNV Homology
BLAST of MC04g0013.1 vs. ExPASy Swiss-Prot
Match: Q3ZC66 (Cysteine-rich PDZ-binding protein OS=Bos taurus OX=9913 GN=CRIPT PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.0e-09 Identity = 29/56 (51.79%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy Swiss-Prot
Match: Q9P021 (Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.0e-09 Identity = 29/56 (51.79%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy Swiss-Prot
Match: O70333 (Cysteine-rich PDZ-binding protein OS=Mus musculus OX=10090 GN=Cript PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.0e-09 Identity = 29/56 (51.79%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy Swiss-Prot
Match: Q792Q4 (Cysteine-rich PDZ-binding protein OS=Rattus norvegicus OX=10116 GN=Cript PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.0e-09 Identity = 29/56 (51.79%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy Swiss-Prot
Match: Q5ZKB6 (Cysteine-rich PDZ-binding protein OS=Gallus gallus OX=9031 GN=CRIPT PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 6.8e-09 Identity = 28/56 (50.00%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of MC04g0013.1 vs. NCBI nr
Match: XP_004496774.1 (cysteine-rich PDZ-binding protein [Cicer arietinum]) HSP 1 Score: 81.6 bits (200), Expect = 1.64e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. NCBI nr
Match: XP_004134750.1 (cysteine-rich PDZ-binding protein [Cucumis sativus] >XP_008439962.1 PREDICTED: cysteine-rich PDZ-binding protein [Cucumis melo] >KGN49130.1 hypothetical protein Csa_004040 [Cucumis sativus] >TYK13064.1 cysteine-rich PDZ-binding protein [Cucumis melo var. makuwa]) HSP 1 Score: 81.6 bits (200), Expect = 1.64e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. NCBI nr
Match: XP_021866364.1 (cysteine-rich PDZ-binding protein [Spinacia oleracea]) HSP 1 Score: 81.6 bits (200), Expect = 1.64e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. NCBI nr
Match: KNA15065.1 (hypothetical protein SOVF_101560, partial [Spinacia oleracea]) HSP 1 Score: 81.6 bits (200), Expect = 2.33e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. NCBI nr
Match: PON31992.1 (PDZ-binding protein, CRIPT [Parasponia andersonii]) HSP 1 Score: 81.6 bits (200), Expect = 2.33e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy TrEMBL
Match: A0A5D3CPV5 (Cysteine-rich PDZ-binding protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G006660 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.95e-19 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy TrEMBL
Match: A0A0A0KHE3 (Cysteine-rich PDZ-binding protein OS=Cucumis sativus OX=3659 GN=Csa_6G514910 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.95e-19 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy TrEMBL
Match: A0A1S2XZ43 (Cysteine-rich PDZ-binding protein OS=Cicer arietinum OX=3827 GN=LOC101506406 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.95e-19 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy TrEMBL
Match: A0A1S3B0M5 (Cysteine-rich PDZ-binding protein OS=Cucumis melo OX=3656 GN=LOC103484593 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.95e-19 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. ExPASy TrEMBL
Match: A0A2P5A629 (Cysteine-rich PDZ-binding protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_365160 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.13e-18 Identity = 39/53 (73.58%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of MC04g0013.1 vs. TAIR 10
Match: AT1G61780.1 (postsynaptic protein-related ) HSP 1 Score: 68.2 bits (165), Expect = 2.3e-12 Identity = 34/55 (61.82%), Postives = 38/55 (69.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|