MC00g_new0378.1 (mRNA) Bitter gourd (Dali-11) v1

Overview


Name	MC00g_new0378.1
Type	mRNA
Organism	Momordica charantia cv. Dali-11 (Bitter gourd (Dali-11) v1)
Description	Unknown protein
Location	scaffold18: 24787 .. 25059 (-)
Sequence length	273
RNA-Seq Expression	MC00g_new0378.1
Synteny	MC00g_new0378.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGTCTTACGAGGTTACTTATGCAAATAGAATGTCAAAATCACAAGGGGAAAGCTCATACAAAGATACAACTAGGGCTAAGTTGGAAGATGATAGAAAACAACATCGCAAGAACAGGCAATTGTTATACTCAGCACAGTCTCACTTGCGAATGAAAGATGGTCGGATTAAGTATTTGGAAAATCTTGTAGAGGAAATTAGGGAACGAGCAGACGGTGCGAGGAAGAGAAGCGGGAACTACAGGATAGAGTTAAAGCATTTCAGTCACGTTTGA

mRNA sequence

ATGTCTTACGAGGTTACTTATGCAAATAGAATGTCAAAATCACAAGGGGAAAGCTCATACAAAGATACAACTAGGGCTAAGTTGGAAGATGATAGAAAACAACATCGCAAGAACAGGCAATTGTTATACTCAGCACAGTCTCACTTGCGAATGAAAGATGGTCGGATTAAGTATTTGGAAAATCTTGTAGAGGAAATTAGGGAACGAGCAGACGGTGCGAGGAAGAGAAGCGGGAACTACAGGATAGAGTTAAAGCATTTCAGTCACGTTTGA

Coding sequence (CDS)

ATGTCTTACGAGGTTACTTATGCAAATAGAATGTCAAAATCACAAGGGGAAAGCTCATACAAAGATACAACTAGGGCTAAGTTGGAAGATGATAGAAAACAACATCGCAAGAACAGGCAATTGTTATACTCAGCACAGTCTCACTTGCGAATGAAAGATGGTCGGATTAAGTATTTGGAAAATCTTGTAGAGGAAATTAGGGAACGAGCAGACGGTGCGAGGAAGAGAAGCGGGAACTACAGGATAGAGTTAAAGCATTTCAGTCACGTTTGA

Protein sequence

MSYEVTYANRMSKSQGESSYKDTTRAKLEDDRKQHRKNRQLLYSAQSHLRMKDGRIKYLENLVEEIRERADGARKRSGNYRIELKHFSHV

Homology

The following BLAST results are available for this feature:

BLAST of MC00g_new0378.1 vs.


Match Name	E-value	Identity	Description

BLAST of MC00g_new0378.1 vs.


Match Name	E-value	Identity	Description

BLAST of MC00g_new0378.1 vs.


Match Name	E-value	Identity	Description

BLAST of MC00g_new0378.1 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 56..76
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..36
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 20..36
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..19

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
MC00g_new0378	MC00g_new0378	gene

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
MC00g_new0378.1-cds	MC00g_new0378.1-cds-scaffold18:24787..25059	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
MC00g_new0378.1	MC00g_new0378.1-protein	polypeptide