IVF0019134.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAGTACCATGACAAACCTCAATATTTTATGAAAGATATTTGTTTTAGATAAAAATATTTTGAGAAAAAGTCTTAAATATGTCTATTTCTTAAATTTCCATGTCAGAGAG ATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAGTACCATGACAAACCTCAATATTTTATGAAAGATATTTGTTTTAGATAAAAATATTTTGAGAAAAAGTCTTAAATATGTCTATTTCTTAAATTTCCATGTCAGAGAG ATGAAAATGGAAACCCACATGACATTTTATTGGGGAAAGACGGTGGAGATCCTCTTCGTCGGCTGGCCCGGTCGGAGCTTTTTCTCTTACACCGTTGCTTTAATCTTTGTTTTTCTTCTCGCCTTCACCGTGGAGTGGCTCTCACACACTAAATTCACCACTCTCGTCGTTGGCAACCTCACTGCCGGCCTGGTTCAGACCATCCTATACGGTGTTCGGGTGGGATTGGCTTTCATTGTCATGCTGGCCGTCATGTCATATAATGTTGGAGTTTTGCTAGCGGCAGTAACTGGATATTCAATGGGGTTCTTGGTTTATGGGAGTCAAGTATTTAGTAGATCGAAAGTTGATCAAAATTTAAATTTAGATTTGTCTGATCTTCCACCACTTAATTGTTAG MKMETHMTFYWGKTVEILFVGWPGRSFFSYTVALIFVFLLAFTVEWLSHTKFTTLVVGNLTAGLVQTILYGVRVGLAFIVMLAVMSYNVGVLLAAVTGYSMGFLVYGSQVFSRSKVDQNLNLDLSDLPPLNC Homology
BLAST of IVF0019134.1 vs. ExPASy Swiss-Prot
Match: Q39065 (Copper transporter 1 OS=Arabidopsis thaliana OX=3702 GN=COPT1 PE=2 SV=2) HSP 1 Score: 125.6 bits (314), Expect = 4.3e-28 Identity = 66/135 (48.89%), Postives = 88/135 (65.19%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy Swiss-Prot
Match: Q9STG2 (Copper transporter 2 OS=Arabidopsis thaliana OX=3702 GN=COPT2 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-23 Identity = 56/117 (47.86%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy Swiss-Prot
Match: Q8GWP3 (Copper transporter 6 OS=Arabidopsis thaliana OX=3702 GN=COPT6 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-22 Identity = 57/114 (50.00%), Postives = 76/114 (66.67%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy Swiss-Prot
Match: Q9FGU8 (Copper transporter 3 OS=Arabidopsis thaliana OX=3702 GN=COPT3 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 7.3e-20 Identity = 51/106 (48.11%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy Swiss-Prot
Match: Q5ZD08 (Copper transporter 3 OS=Oryza sativa subsp. japonica OX=39947 GN=COPT3 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 5.8e-17 Identity = 52/106 (49.06%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy TrEMBL
Match: A0A5D3BC00 (Copper transporter OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G001700 PE=3 SV=1) HSP 1 Score: 255.4 bits (651), Expect = 1.3e-64 Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy TrEMBL
Match: A0A5A7SL08 (Copper transporter OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold848G00120 PE=3 SV=1) HSP 1 Score: 253.8 bits (647), Expect = 3.9e-64 Identity = 131/132 (99.24%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy TrEMBL
Match: A0A0A0LXH5 (Copper transporter OS=Cucumis sativus OX=3659 GN=Csa_1G526835 PE=3 SV=1) HSP 1 Score: 221.1 bits (562), Expect = 2.8e-54 Identity = 110/130 (84.62%), Postives = 120/130 (92.31%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy TrEMBL
Match: A0A6J1KDT9 (Copper transporter OS=Cucurbita maxima OX=3661 GN=LOC111493433 PE=3 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 6.8e-45 Identity = 95/130 (73.08%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of IVF0019134.1 vs. ExPASy TrEMBL
Match: A0A6J1GAH5 (Copper transporter OS=Cucurbita moschata OX=3662 GN=LOC111452258 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 1.2e-44 Identity = 95/130 (73.08%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of IVF0019134.1 vs. NCBI nr
Match: TYJ97360.1 (putative Copper transporter [Cucumis melo var. makuwa]) HSP 1 Score: 256 bits (655), Expect = 5.75e-86 Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of IVF0019134.1 vs. NCBI nr
Match: KAA0031772.1 (putative Copper transporter [Cucumis melo var. makuwa]) HSP 1 Score: 255 bits (651), Expect = 2.34e-85 Identity = 131/132 (99.24%), Postives = 132/132 (100.00%), Query Frame = 0
BLAST of IVF0019134.1 vs. NCBI nr
Match: XP_023525766.1 (copper transporter 1-like [Cucurbita pepo subsp. pepo] >KAG7036956.1 Copper transporter 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 191 bits (485), Expect = 4.17e-60 Identity = 96/130 (73.85%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of IVF0019134.1 vs. NCBI nr
Match: XP_022998910.1 (copper transporter 1-like [Cucurbita maxima]) HSP 1 Score: 191 bits (484), Expect = 5.93e-60 Identity = 95/130 (73.08%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of IVF0019134.1 vs. NCBI nr
Match: XP_022948639.1 (copper transporter 1-like [Cucurbita moschata]) HSP 1 Score: 190 bits (482), Expect = 1.20e-59 Identity = 95/130 (73.08%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of IVF0019134.1 vs. TAIR 10
Match: AT5G59030.1 (copper transporter 1 ) HSP 1 Score: 125.6 bits (314), Expect = 3.0e-29 Identity = 66/135 (48.89%), Postives = 88/135 (65.19%), Query Frame = 0
BLAST of IVF0019134.1 vs. TAIR 10
Match: AT3G46900.1 (copper transporter 2 ) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-24 Identity = 56/117 (47.86%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of IVF0019134.1 vs. TAIR 10
Match: AT2G26975.1 (Ctr copper transporter family ) HSP 1 Score: 107.5 bits (267), Expect = 8.6e-24 Identity = 57/114 (50.00%), Postives = 76/114 (66.67%), Query Frame = 0
BLAST of IVF0019134.1 vs. TAIR 10
Match: AT5G59040.1 (copper transporter 3 ) HSP 1 Score: 98.2 bits (243), Expect = 5.2e-21 Identity = 51/106 (48.11%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of IVF0019134.1 vs. TAIR 10
Match: AT2G37925.1 (copper transporter 4 ) HSP 1 Score: 84.3 bits (207), Expect = 7.8e-17 Identity = 46/109 (42.20%), Postives = 67/109 (61.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|