IVF0008589.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATAAGTGGAAAGGTTCTGGAAAACTAGGAAGACTGGTGCCGAGAGGTGGTTCTATGACTTCTTACAAGTATGCTCTTCTGTTGTCACCTGTTGTCTCTGTTTGGGATTGCATTGTCAGGAAAATGAGGTATTCCTACAGACCTGAGTGGGTGTAG ATGGATAAGTGGAAAGGTTCTGGAAAACTAGGAAGACTGGTGCCGAGAGGTGGTTCTATGACTTCTTACAAGTATGCTCTTCTGTTGTCACCTGTTGTCTCTGTTTGGGATTGCATTGTCAGGAAAATGAGGTATTCCTACAGACCTGAGTGGGTGTAG ATGGATAAGTGGAAAGGTTCTGGAAAACTAGGAAGACTGGTGCCGAGAGGTGGTTCTATGACTTCTTACAAGTATGCTCTTCTGTTGTCACCTGTTGTCTCTGTTTGGGATTGCATTGTCAGGAAAATGAGGTATTCCTACAGACCTGAGTGGGTGTAG MDKWKGSGKLGRLVPRGGSMTSYKYALLLSPVVSVWDCIVRKMRYSYRPEWV Homology
BLAST of IVF0008589.1 vs. ExPASy TrEMBL
Match: A0A1S3AY20 (uncharacterized protein LOC103484116 OS=Cucumis melo OX=3656 GN=LOC103484116 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.9e-22 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0008589.1 vs. ExPASy TrEMBL
Match: A0A5A7SWR1 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold239G001680 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.9e-22 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0008589.1 vs. ExPASy TrEMBL
Match: A0A6J5WRR2 (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS17860 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of IVF0008589.1 vs. ExPASy TrEMBL
Match: A0A498KSB3 (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_042840 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of IVF0008589.1 vs. ExPASy TrEMBL
Match: A0A251QNM1 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G300500 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of IVF0008589.1 vs. NCBI nr
Match: XP_008439287.1 (PREDICTED: uncharacterized protein LOC103484116 [Cucumis melo] >XP_016899083.1 PREDICTED: uncharacterized protein LOC103484116 [Cucumis melo]) HSP 1 Score: 114 bits (285), Expect = 5.65e-32 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0008589.1 vs. NCBI nr
Match: KAA0033697.1 (uncharacterized protein E6C27_scaffold239G001680 [Cucumis melo var. makuwa]) HSP 1 Score: 114 bits (285), Expect = 2.03e-31 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of IVF0008589.1 vs. NCBI nr
Match: KAG7013257.1 (hypothetical protein SDJN02_26015, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 108 bits (270), Expect = 2.95e-29 Identity = 49/52 (94.23%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of IVF0008589.1 vs. NCBI nr
Match: KAB2598673.1 (hypothetical protein D8674_001593 [Pyrus ussuriensis x Pyrus communis] >ONI25398.1 hypothetical protein PRUPE_2G300500 [Prunus persica]) HSP 1 Score: 94.4 bits (233), Expect = 4.59e-24 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of IVF0008589.1 vs. NCBI nr
Match: XP_016650179.1 (PREDICTED: uncharacterized protein LOC103333726 isoform X2 [Prunus mume] >XP_016650180.1 PREDICTED: uncharacterized protein LOC103333726 isoform X2 [Prunus mume]) HSP 1 Score: 94.4 bits (233), Expect = 5.73e-24 Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 0
BLAST of IVF0008589.1 vs. TAIR 10
Match: AT5G52552.1 (conserved peptide upstream open reading frame 14 ) HSP 1 Score: 73.6 bits (179), Expect = 5.4e-14 Identity = 34/52 (65.38%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of IVF0008589.1 vs. TAIR 10
Match: AT4G25672.1 (conserved peptide upstream open reading frame 12 ) HSP 1 Score: 68.6 bits (166), Expect = 1.7e-12 Identity = 31/52 (59.62%), Postives = 37/52 (71.15%), Query Frame = 0
BLAST of IVF0008589.1 vs. TAIR 10
Match: AT4G25692.1 (conserved peptide upstream open reading frame 13 ) HSP 1 Score: 56.2 bits (134), Expect = 8.9e-09 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|