IVF0007433.1 (mRNA) Melon (IVF77) v1

Overview


Name	IVF0007433.1
Type	mRNA
Organism	Cucumis melo L. ssp. agrestis cv. IVF77 (Melon (IVF77) v1)
Description	Unknown protein
Location	chr08: 26925385 .. 26925549 (-)
Sequence length	165
RNA-Seq Expression	IVF0007433.1
Synteny	IVF0007433.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: exonCDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGACGGCGAGGAGTGTCTGGAAAGGTCCAGAAGGCCAAAGGACATCCGAAGTAGTGGCTGAACGTGCGAAGGATCCAAATGGCTCAAGAAAACATGCGCACGCACATGCTAGGCACATTCAGACACATCTAGAAGCTTCTATGACGGTTCGAAGGATACAATGA

mRNA sequence

ATGACGGCGAGGAGTGTCTGGAAAGGTCCAGAAGGCCAAAGGACATCCGAAGTAGTGGCTGAACGTGCGAAGGATCCAAATGGCTCAAGAAAACATGCGCACGCACATGCTAGGCACATTCAGACACATCTAGAAGCTTCTATGACGGTTCGAAGGATACAATGA

Coding sequence (CDS)

ATGACGGCGAGGAGTGTCTGGAAAGGTCCAGAAGGCCAAAGGACATCCGAAGTAGTGGCTGAACGTGCGAAGGATCCAAATGGCTCAAGAAAACATGCGCACGCACATGCTAGGCACATTCAGACACATCTAGAAGCTTCTATGACGGTTCGAAGGATACAATGA

Protein sequence

MTARSVWKGPEGQRTSEVVAERAKDPNGSRKHAHAHARHIQTHLEASMTVRRIQ

Homology

The following BLAST results are available for this feature:

BLAST of IVF0007433.1 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0007433.1 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0007433.1 vs.


Match Name	E-value	Identity	Description

BLAST of IVF0007433.1 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	COILS	Coil	Coil	coord: 53..54
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 15..30
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..34

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
IVF0007433	IVF0007433	gene

The following exon feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
IVF0007433.1-exon	IVF0007433.1-exon-chr08:26925385..26925549	exon

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
IVF0007433.1-cds	IVF0007433.1-cds-chr08:26925385..26925549	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
IVF0007433.1	IVF0007433.1-protein	polypeptide