IVF0006547.2 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTGCAGACTGGGGTCCAGTTGTGGTGGCGGTGGCTTTGTTCATTCTCCTCTCGCCGGGGCTGCTTTTTCAGTTGCCGGCGAGAATCAGGGTGGTGGAGTTCGGGAATATGAACACCAGTGGGATTGCCATTTGGTACATGCCATCATATTCTTCTGCATACTTACCATATTGATCATTGCAATTGGTATTCACATACACGTTTAG ATGAGTGCAGACTGGGGTCCAGTTGTGGTGGCGGTGGCTTTGTTCATTCTCCTCTCGCCGGGGCTGCTTTTTCAGTTGCCGGCGAGAATCAGGTGGGATTGCCATTTGGTACATGCCATCATATTCTTCTGCATACTTACCATATTGATCATTGCAATTGGTATTCACATACACGTTTAG ATGAGTGCAGACTGGGGTCCAGTTGTGGTGGCGGTGGCTTTGTTCATTCTCCTCTCGCCGGGGCTGCTTTTTCAGTTGCCGGCGAGAATCAGGTGGGATTGCCATTTGGTACATGCCATCATATTCTTCTGCATACTTACCATATTGATCATTGCAATTGGTATTCACATACACGTTTAG MSADWGPVVVAVALFILLSPGLLFQLPARIRWDCHLVHAIIFFCILTILIIAIGIHIHV Homology
BLAST of IVF0006547.2 vs. ExPASy TrEMBL
Match: A0A0A0LQ54 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G406090 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.5e-15 Identity = 55/69 (79.71%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. ExPASy TrEMBL
Match: A0A1S3B3T8 (uncharacterized protein LOC103485471 OS=Cucumis melo OX=3656 GN=LOC103485471 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.5e-15 Identity = 55/69 (79.71%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. ExPASy TrEMBL
Match: A0A6J1JT68 (uncharacterized protein LOC111487624 OS=Cucurbita maxima OX=3661 GN=LOC111487624 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 4.3e-15 Identity = 53/69 (76.81%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. ExPASy TrEMBL
Match: A0A6J1JYL4 (uncharacterized protein LOC111489052 OS=Cucurbita maxima OX=3661 GN=LOC111489052 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 4.3e-15 Identity = 53/69 (76.81%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. ExPASy TrEMBL
Match: A0A6J1BXY0 (uncharacterized protein LOC111006600 OS=Momordica charantia OX=3673 GN=LOC111006600 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 4.3e-15 Identity = 52/68 (76.47%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of IVF0006547.2 vs. NCBI nr
Match: XP_008441321.1 (PREDICTED: uncharacterized protein LOC103485471 [Cucumis melo] >XP_011649953.1 uncharacterized protein LOC105434681 [Cucumis sativus] >XP_038884724.1 uncharacterized protein LOC120075416 [Benincasa hispida]) HSP 1 Score: 90.5 bits (223), Expect = 3.19e-22 Identity = 55/69 (79.71%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. NCBI nr
Match: XP_022134305.1 (uncharacterized protein LOC111006600 [Momordica charantia]) HSP 1 Score: 89.0 bits (219), Expect = 1.30e-21 Identity = 52/68 (76.47%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of IVF0006547.2 vs. NCBI nr
Match: XP_022939393.1 (uncharacterized protein LOC111445324 [Cucurbita moschata] >XP_022992844.1 uncharacterized protein LOC111489052 [Cucurbita maxima] >XP_023550674.1 uncharacterized protein LOC111808749 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 89.0 bits (219), Expect = 1.30e-21 Identity = 53/69 (76.81%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. NCBI nr
Match: XP_022961461.1 (uncharacterized protein LOC111462035 [Cucurbita moschata] >XP_022990859.1 uncharacterized protein LOC111487624 [Cucurbita maxima] >XP_023522991.1 uncharacterized protein LOC111787076 [Cucurbita pepo subsp. pepo] >XP_023544168.1 uncharacterized protein LOC111803819 [Cucurbita pepo subsp. pepo] >XP_023544180.1 uncharacterized protein LOC111803828 [Cucurbita pepo subsp. pepo] >KAG7033374.1 hypothetical protein SDJN02_07430, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 89.0 bits (219), Expect = 1.34e-21 Identity = 53/69 (76.81%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. NCBI nr
Match: XP_021653637.1 (uncharacterized protein LOC110644967 [Hevea brasiliensis]) HSP 1 Score: 86.3 bits (212), Expect = 1.56e-20 Identity = 51/69 (73.91%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0006547.2 vs. TAIR 10
Match: AT5G40980.1 (Protein of unknown function (DUF 3339) ) HSP 1 Score: 83.6 bits (205), Expect = 5.9e-17 Identity = 50/68 (73.53%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of IVF0006547.2 vs. TAIR 10
Match: AT3G27027.1 (Protein of unknown function (DUF 3339) ) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-15 Identity = 46/68 (67.65%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of IVF0006547.2 vs. TAIR 10
Match: AT3G01940.1 (Protein of unknown function (DUF 3339) ) HSP 1 Score: 73.2 bits (178), Expect = 8.0e-14 Identity = 43/67 (64.18%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of IVF0006547.2 vs. TAIR 10
Match: AT3G48660.1 (Protein of unknown function (DUF 3339) ) HSP 1 Score: 62.0 bits (149), Expect = 1.8e-10 Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of IVF0006547.2 vs. TAIR 10
Match: AT5G63500.1 (Protein of unknown function (DUF 3339) ) HSP 1 Score: 60.5 bits (145), Expect = 5.4e-10 Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|